HPN (hepsin)

Gene

• Entrez ID: 3249
• Gene name: Hepsin
• Gene symbol: HPN
• Synonyms (NCBI Gene): TMPRSS1
• Chromosome: 19
• Chromosome location: 19q13.11
• Summary: This gene encodes a type II transmembrane serine protease that may be involved in diverse cellular functions, including blood coagulation and the maintenance of cell morphology. Expression of the encoded protein is associated with the growth and progressi

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004197	hsa-miR-197-3p	Microarray	16822819
MIRT2451360	hsa-miR-3190	CLIP-seq
MIRT2451361	hsa-miR-4252	CLIP-seq
MIRT2451362	hsa-miR-4258	CLIP-seq
MIRT2451363	hsa-miR-4308	CLIP-seq
MIRT2451364	hsa-miR-4318	CLIP-seq
MIRT2451365	hsa-miR-4707-3p	CLIP-seq
MIRT2451366	hsa-miR-4725-5p	CLIP-seq
MIRT2451367	hsa-miR-4751	CLIP-seq
MIRT2451368	hsa-miR-504	CLIP-seq
MIRT2451369	hsa-miR-7	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16908524
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	15614436, 19911255, 32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	17918732
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1885621, 8346233
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	ISS
GO:0006508	Process	Proteolysis	IDA	16908524, 19843851, 19911255, 24227843
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	16908524, 19843851
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IDA	19911255
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	1885621
GO:0008360	Process	Regulation of cell shape	IMP	8346233
GO:0009986	Component	Cell surface	IDA	8346233, 16908524
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19843851
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	16908524
GO:0016020	Component	Membrane	IDA	19843851
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016485	Process	Protein processing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	8346233
GO:0031965	Component	Nuclear membrane	IDA	15614436
GO:0034769	Process	Basement membrane disassembly	IDA	16908524
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15614436
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	15614436
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19843851
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070008	Function	Serine-type exopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090103	Process	Cochlea morphogenesis	ISS
GO:0097066	Process	Response to thyroid hormone	ISS
GO:0097195	Process	Pilomotor reflex	ISS
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IDA	15614436
GO:2000611	Process	Positive regulation of thyroid hormone generation	ISS

Other IDs

• MIM: 142440
• HGNC: 5155
• e!Ensembl: ENSG00000105707

Protein

• UniProt ID: P05981
• Protein name: Serine protease hepsin (EC 3.4.21.106) (Transmembrane protease serine 1) [Cleaved into: Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain]
• Protein function: Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL (PubMed:15839837, PubMed:21875933). Plays a role in cell growth and maintenance of cell morphology
• PDB: 1O5E, 1O5F, 1P57, 1Z8G, 3T2N, 5CE1
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09272	Hepsin-SRCR	50 → 159	Hepsin, SRCR domain	Domain
  PF00089	Trypsin	163 → 400	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in liver and kidney. {ECO:0000269|PubMed:21875933}.
• Sequence:

  MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
  ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
  DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
  RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
  GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
  YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
  DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

• Sequence length: 417

Pathways

KEGG:

Viral carcinogenesis

Reactome:

MET Receptor Activation
Signaling by MST1