Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3249
Gene name Gene Name - the full gene name approved by the HGNC.	Hepsin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HPN
Synonyms (NCBI Gene) Gene synonyms aliases	TMPRSS1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a type II transmembrane serine protease that may be involved in diverse cellular functions, including blood coagulation and the maintenance of cell morphology. Expression of the encoded protein is associated with the growth and progressi

Show/Hide all(19)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004197	hsa-miR-197-3p	Microarray	16822819
MIRT2451360	hsa-miR-3190	CLIP-seq
MIRT2451361	hsa-miR-4252	CLIP-seq
MIRT2451362	hsa-miR-4258	CLIP-seq
MIRT2451363	hsa-miR-4308	CLIP-seq
MIRT2451364	hsa-miR-4318	CLIP-seq
MIRT2451365	hsa-miR-4707-3p	CLIP-seq
MIRT2451366	hsa-miR-4725-5p	CLIP-seq
MIRT2451367	hsa-miR-4751	CLIP-seq
MIRT2451368	hsa-miR-504	CLIP-seq
MIRT2451369	hsa-miR-7	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq
MIRT2547512	hsa-miR-1323	CLIP-seq
MIRT2547513	hsa-miR-4795-3p	CLIP-seq
MIRT2547514	hsa-miR-548aa	CLIP-seq
MIRT2547515	hsa-miR-548o	CLIP-seq

Show/Hide all(45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IDA	16908524
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005515	Function	Protein binding	IPI	15614436, 19911255, 32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	17918732
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1885621, 8346233
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005911	Component	Cell-cell junction	ISS
GO:0006508	Process	Proteolysis	IDA	16908524, 19843851, 19911255, 24227843
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IDA	16908524, 19843851
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IBA
GO:0008236	Function	Serine-type peptidase activity	IDA	19911255
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	1885621
GO:0008360	Process	Regulation of cell shape	IMP	8346233
GO:0009986	Component	Cell surface	IDA	8346233, 16908524
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IDA	19843851
GO:0010756	Process	Positive regulation of plasminogen activation	IDA	16908524
GO:0016020	Component	Membrane	IDA	19843851
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016485	Process	Protein processing	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	8346233
GO:0031965	Component	Nuclear membrane	IDA	15614436
GO:0034769	Process	Basement membrane disassembly	IDA	16908524
GO:0043025	Component	Neuronal cell body	ISS
GO:0043066	Process	Negative regulation of apoptotic process	IDA	15614436
GO:0043923	Process	Host-mediated activation of viral transcription	IDA	15614436
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	19843851
GO:0050910	Process	Detection of mechanical stimulus involved in sensory perception of sound	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070008	Function	Serine-type exopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071805	Process	Potassium ion transmembrane transport	ISS
GO:0090103	Process	Cochlea morphogenesis	ISS
GO:0097066	Process	Response to thyroid hormone	ISS
GO:0097195	Process	Pilomotor reflex	ISS
GO:2000347	Process	Positive regulation of hepatocyte proliferation	IDA	15614436
GO:2000611	Process	Positive regulation of thyroid hormone generation	ISS

MIM	HGNC	e!Ensembl
142440	5155	ENSG00000105707

Protein

UniProt ID

P05981

Protein name

Serine protease hepsin (EC 3.4.21.106) (Transmembrane protease serine 1) [Cleaved into: Serine protease hepsin non-catalytic chain; Serine protease hepsin catalytic chain]

Protein function

Serine protease that cleaves extracellular substrates, and contributes to the proteolytic processing of growth factors, such as HGF and MST1/HGFL (PubMed:15839837, PubMed:21875933). Plays a role in cell growth and maintenance of cell morphology

PDB

1O5E , 1O5F , 1P57 , 1Z8G , 3T2N , 5CE1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09272	Hepsin-SRCR	50 → 159	Hepsin, SRCR domain	Domain
PF00089	Trypsin	163 → 400	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in liver and kidney. {ECO:0000269|PubMed:21875933}.

Sequence

MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL

Sequence length

417

Interactions

View interactions

	KEGG		Reactome
	Viral carcinogenesis		MET Receptor Activation Signaling by MST1

Show/Hide Unknown Diseases (1)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Diabetes	Triglyceride levels in non-type 2 diabetes	N/A	N/A	GWAS

Show/Hide Text Mining Associations (16)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Breast Neoplasms	Associate	25029565, 26014348
Carcinogenesis	Associate	15839837
Carcinoma Hepatocellular	Inhibit	35164791
Carcinoma Renal Cell	Inhibit	17309599
Endometrial Neoplasms	Stimulate	18383840
Hypersensitivity Immediate	Associate	26645624
Lymphatic Metastasis	Stimulate	18383840
Neoplasm Metastasis	Stimulate	17309599
Neoplasms	Associate	17309599, 18383840, 21875933, 26014348, 26442953, 35164791
Neoplasms	Stimulate	27841306
Ovarian Diseases	Stimulate	18383840
Ovarian Neoplasms	Associate	15839837
Prostatic Hyperplasia	Associate	37781794
Prostatic Neoplasms	Associate	11518967, 12057920, 15928670, 20037200, 20166135, 20441232, 33032611, 37781794
Prostatic Neoplasms	Inhibit	35484884
Stomach Neoplasms	Associate	27841306

HPN (hepsin)