Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3232
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox D3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXD3
Synonyms (NCBI Gene) Gene synonyms aliases
HOX1D, HOX4, HOX4A, Hox-4.1
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q31.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene cluster
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT050780 hsa-miR-17-3p CLASH 23622248
MIRT484667 hsa-miR-1247-3p PAR-CLIP 20371350
MIRT484662 hsa-miR-6087 PAR-CLIP 20371350
MIRT484661 hsa-miR-6132 PAR-CLIP 20371350
MIRT484660 hsa-miR-6836-5p PAR-CLIP 20371350
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IDA 7913891
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142980 5137 ENSG00000128652
Protein
UniProt ID P31249
Protein name Homeobox protein Hox-D3 (Homeobox protein Hox-4A)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 195 251 Homeodomain Domain
PF13293 DUF4074 369 430 Domain of unknown function (DUF4074) Family
Sequence
MLFEQGQQALELPECTMQKAAYYENPGLFGGYGYSKTTDTYGYSTPHQPYPPPAAASSLD
TDYPGSACSIQSSAPLRAPAHKGAELNGSCMRPGTGNSQGGGGGSQPPGLNSEQQPPQPP
PPPPTLPPSSPTNPGGGVPAKKPKGGPNASSSSATISKQIFPWMKESRQNSKQKNSCATA
GESCEDKSPPGPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKI
WFQNRRMKYKK
DQKAKGILHSPASQSPERSPPLGGAAGHVAYSGQLPPVPGLAYDAPSPP
AFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEPHPMASNGGGFASANLQGSPVYVGG
NFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCDPHPTYTDLSAHHSSQ
GRLPEAPKLT
HL
Sequence length 432
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Motion Sickness Motion sickness N/A N/A GWAS
Ovarian cancer Epithelial ovarian cancer N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 28691018, 29698974
Carcinogenesis Associate 34028973
Carcinoma Hepatocellular Associate 28418032, 29402992, 32557953, 34028973
Carcinoma Ovarian Epithelial Associate 26391404
Carcinoma Renal Cell Associate 37827698
Colorectal Neoplasms Associate 27499213
Glioblastoma Associate 35594842, 40209540
Glioma Associate 18404365
Leukemia Erythroblastic Acute Associate 7742539
Lung Neoplasms Associate 25802847