HOXB5 (homeobox B5)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3215
Gene name Gene Name - the full gene name approved by the HGNC.
Homeobox B5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HOXB5
Synonyms (NCBI Gene) Gene synonyms aliases
HHO.C10, HOX2, HOX2A, HU-1, Hox2.1
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcriptio
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(155)
miRTarBase ID miRNA Experiments Reference
MIRT001971 hsa-miR-221-3p Gluc assay 18794255
MIRT006902 hsa-miR-7-5p Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot 22768238
MIRT016641 hsa-miR-429 Reporter assay 20005803
MIRT020354 hsa-miR-200a-3p Reporter assay 20005803
MIRT021075 hsa-miR-200c-3p Reporter assay 20005803
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
142960 5116 ENSG00000120075
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID P09067
Protein name Homeobox protein Hox-B5 (Homeobox protein HHO.C10) (Homeobox protein Hox-2A) (Homeobox protein Hu-1)
Protein function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 195 → 251 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Spinal cord.
Sequence 
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYNGMDLSVNRSS
ASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESLPCTNGDSHGAKPSASSPSDQ
ATSASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEGQTPQIFPWM
RKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKI
WFQNRRMKWKKDNKLKSMSLATAGSAFQP
Sequence length 269
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Obesity Obesity rs74315349, rs1474810899, rs121918111, rs796065034, rs753856820, rs796065035, rs121918112, rs104894023, rs137852821, rs1580764441, rs137852822, rs137852823, rs137852824, rs13447324, rs121913562
View all (27 more)		 22484627
Show/Hide Text Mining Associations (18)
Associations from Text Mining
Disease Name Relationship Type References
Barrett Esophagus Stimulate 22603795
Breast Neoplasms Associate 25999793
Breast Neoplasms Stimulate 30115380
Carcinoma Basal Cell Associate 32382535
Carcinoma Non Small Cell Lung Associate 37304647
Carcinoma Small Cell Associate 33664492
Ependymoma Stimulate 14578171
Glioma Associate 35044082
Hirschsprung Disease Associate 22648184
Leukemia Associate 1372255