Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3201
Gene name Gene Name - the full gene name approved by the HGNC.	Homeobox A4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HOXA4
Synonyms (NCBI Gene) Gene synonyms aliases	HOX1, HOX1D
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7p15.2
Summary Summary of gene provided in NCBI Entrez Gene.	In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic develo

Show/Hide all(44)

miRTarBase ID	miRNA	Experiments
MIRT1053158	hsa-miR-1253	CLIP-seq
MIRT1053159	hsa-miR-1255a	CLIP-seq
MIRT1053160	hsa-miR-1255b	CLIP-seq
MIRT1053161	hsa-miR-1275	CLIP-seq
MIRT1053162	hsa-miR-1294	CLIP-seq
MIRT1053163	hsa-miR-22	CLIP-seq
MIRT1053164	hsa-miR-300	CLIP-seq
MIRT1053165	hsa-miR-3160-3p	CLIP-seq
MIRT1053166	hsa-miR-3165	CLIP-seq
MIRT1053167	hsa-miR-3618	CLIP-seq
MIRT1053168	hsa-miR-3653	CLIP-seq
MIRT1053169	hsa-miR-3658	CLIP-seq
MIRT1053170	hsa-miR-3691-5p	CLIP-seq
MIRT1053171	hsa-miR-381	CLIP-seq
MIRT1053172	hsa-miR-3915	CLIP-seq
MIRT1053173	hsa-miR-3928	CLIP-seq
MIRT1053174	hsa-miR-4271	CLIP-seq
MIRT1053175	hsa-miR-4316	CLIP-seq
MIRT1053176	hsa-miR-4434	CLIP-seq
MIRT1053177	hsa-miR-4453	CLIP-seq
MIRT1053178	hsa-miR-4475	CLIP-seq
MIRT1053179	hsa-miR-4487	CLIP-seq
MIRT1053180	hsa-miR-4506	CLIP-seq
MIRT1053181	hsa-miR-4516	CLIP-seq
MIRT1053182	hsa-miR-4525	CLIP-seq
MIRT1053183	hsa-miR-4538	CLIP-seq
MIRT1053184	hsa-miR-4643	CLIP-seq
MIRT1053185	hsa-miR-4651	CLIP-seq
MIRT1053186	hsa-miR-466	CLIP-seq
MIRT1053187	hsa-miR-4665-5p	CLIP-seq
MIRT1053188	hsa-miR-4722-5p	CLIP-seq
MIRT1053189	hsa-miR-4723-5p	CLIP-seq
MIRT1053190	hsa-miR-4725-3p	CLIP-seq
MIRT1053191	hsa-miR-4729	CLIP-seq
MIRT1053192	hsa-miR-4761-5p	CLIP-seq
MIRT1053193	hsa-miR-4768-3p	CLIP-seq
MIRT1053194	hsa-miR-4789-3p	CLIP-seq
MIRT1053195	hsa-miR-556-5p	CLIP-seq
MIRT1053196	hsa-miR-558	CLIP-seq
MIRT1053197	hsa-miR-581	CLIP-seq
MIRT1053198	hsa-miR-608	CLIP-seq
MIRT1053199	hsa-miR-625	CLIP-seq
MIRT1053200	hsa-miR-935	CLIP-seq
MIRT2547322	hsa-miR-4778-3p	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TFAP2A	Repression	8759021

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	21873635
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0005634	Component	Nucleus	IBA	21873635
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0009653	Process	Anatomical structure morphogenesis	TAS	1675427
GO:0009952	Process	Anterior/posterior pattern specification	IBA	21873635
GO:0016604	Component	Nuclear body	IDA
GO:0048704	Process	Embryonic skeletal system morphogenesis	IBA	21873635
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
142953	5105	ENSG00000197576

Protein

UniProt ID

Q00056

Protein name

Homeobox protein Hox-A4 (Homeobox protein Hox-1.4) (Homeobox protein Hox-1D)

Protein function

Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to sites in the 5'-flanking sequence of its coding region wit

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	216 → 272	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Embryonic nervous system.

Sequence

MTMSSFLINSNYIEPKFPPFEEYAQHSGSGGADGGPGGGPGYQQPPAPPTQHLPLQQPQL
PHAGGGREPTASYYAPRTAREPAYPAAALYPAHGAADTAYPYGYRGGASPGRPPQPEQPP
AQAKGPAHGLHASHVLQPQLPPPLQPRAVPPAAPRRCEAAPATPGVPAGGSAPACPLLLA
DKSPLGLKGKEPVVYPWMKKIHVSAVNPSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYL
TRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNSASASAGPPGKAQTQ
SPHLHPHPHPSTSTPVPSSI

Sequence length

320

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Hypospadias	Hypospadias			GWAS

Show/Hide Text Mining Associations (26)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	31503425, 35370463
Carcinogenesis	Associate	16127744, 23980595
Carcinoma Renal Cell	Associate	32444962
Chromosome 7 trisomy mosaic	Associate	24247273
Colitis Ulcerative	Inhibit	16127744
Colonic Neoplasms	Stimulate	23980595
Colorectal Neoplasms	Inhibit	16127744
Fetal Growth Retardation	Associate	29146936
Glioma	Stimulate	35349479
Glioma	Associate	35852388
Job Syndrome	Associate	32541515
Leukemia	Associate	17785556
Leukemia Lymphocytic Chronic B Cell	Associate	21051931
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	17785556, 23484077, 32721103
Leukemia Myeloid Acute	Stimulate	31426381
Leukemia Prolymphocytic T Cell	Associate	33082556
Lung Neoplasms	Associate	29667179, 34008478
Nasopharyngeal Carcinoma	Associate	32541515
Neoplasms	Associate	19723874, 35852388
Neoplasms	Stimulate	23980595
Ovarian Neoplasms	Associate	19723874
Periodontal Diseases	Associate	37464577
Periodontitis	Associate	37464577
Silver Russell Syndrome	Associate	29146936
Stomach Neoplasms	Associate	28121923
Werner Syndrome	Associate	31259468

HOXA4 (homeobox A4)