TAAR6 (trace amine associated receptor 6)

Gene

• Entrez ID: 319100
• Gene name: Trace amine associated receptor 6
• Gene symbol: TAAR6
• Synonyms (NCBI Gene): TA4, TAR4, TAR6, TRAR4, taR-4, taR-6
• Chromosome: 6
• Chromosome location: 6q23.2
• Summary: This gene encodes a seven-transmembrane G-protein-coupled receptor that likely functions as a receptor for endogenous trace amines. Mutations in this gene may be associated with schizophrenia.[provided by RefSeq, Feb 2010]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025149	hsa-miR-181a-5p	Microarray	17612493

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001594	Function	Trace-amine receptor activity	IBA
GO:0001594	Function	Trace-amine receptor activity	IEA
GO:0001594	Function	Trace-amine receptor activity	ISS
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	15718104
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	37225986
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	15718104
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0007608	Process	Sensory perception of smell	ISS
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 608923
• HGNC: 20978
• e!Ensembl: ENSG00000146383

Protein

• UniProt ID: Q96RI8
• Protein name: Trace amine-associated receptor 6 (TaR-6) (Trace amine receptor 6) (Trace amine receptor 4) (TaR-4)
• Protein function: Olfactory receptor specific for trace amines, such as beta-phenylethylamine (beta-PEA). Trace amine compounds are enriched in animal body fluids and act on trace amine-associated receptors (TAARs) to elicit both intraspecific and interspecific i
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	49 → 311	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low abundance in various brain tissues, as well as in fetal liver, but not in the cerebellum or placenta (PubMed:15329799). In the brain, comparable levels of expression in basal ganglia, frontal cortex, substantia nigra,
• Sequence:

  MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHF
  KQLHSPTNFLVASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSL
  FHLCFISIDRYIAVTDPLVYPTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEEL
  SDALNCIGGCQTVVNQNWVLTDFLSFFIPTFIMIILYGNIFLVARRQAKKIENTGSKTES
  SSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLIDAFMGFITPACIYEICCWCA
  YYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI

• Sequence length: 345

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Amine ligand-binding receptors
G alpha (s) signalling events
ADORA2B mediated anti-inflammatory cytokines production