Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3142
Gene name Gene Name - the full gene name approved by the HGNC.
H2.0 like homeobox
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HLX
Synonyms (NCBI Gene) Gene synonyms aliases
HB24, HLX1
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1q41
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT052679 hsa-miR-1260b CLASH 23622248
MIRT717649 hsa-miR-1276 HITS-CLIP 19536157
MIRT717648 hsa-miR-5582-5p HITS-CLIP 19536157
MIRT717647 hsa-miR-3622a-5p HITS-CLIP 19536157
MIRT717646 hsa-miR-645 HITS-CLIP 19536157
Transcription factors
Transcription factor Regulation Reference
POU5F1 Repression 17068183
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001889 Process Liver development IEA
GO:0005515 Function Protein binding IPI 23455154, 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142995 4978 ENSG00000136630
Protein
UniProt ID Q14774
Protein name H2.0-like homeobox protein (Homeobox protein HB24) (Homeobox protein HLX1)
Protein function Transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 277 333 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Low level in normal B and T-cells, high level in activated lymphocytes and monocytes. Also found in thymus, tonsil, bone marrow, developing vessels, and fetal brain.
Sequence
MFAAGLAPFYASNFSLWSAAYCSSAGPGGCSFPLDPAAVKKPSFCIADILHAGVGDLGAA
PEGLAGASAAALTAHLGSVHPHASFQAAARSPLRPTPVVAPSEVPAGFPQRLSPLSAAYH
HHHPQQQQQQQQPQQQQPPPPPRAGALQPPASGTRVVPNPHHSGSAPAPSSKDLKFGIDR
ILSAEFDPKVKEGNTLRDLTSLLTGGRPAGVHLSGLQPSAGQFFASLDPINEASAILSPL
NSNPRNSVQHQFQDTFPGPYAVLTKDTMPQTYKRKRSWSRAVFSNLQRKGLEKRFEIQKY
VTKPDRKQLAAMLGLTDAQVKVWFQNRRMKWRH
SKEAQAQKDKDKEAGEKPSGGAPAADG
EQDERSPSRSEGEAESESSDSESLDMAPSDTERTEGSERSLHQTTVIKAPVTGALITASS
AGSGGSSGGGGNSFSFSSASSLSSSSTSAGCASSLGGGGASELLPATQPTASSAPKSPEP
AQGALGCL
Sequence length 488
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Unknown
Disease term Disease name Evidence References Source
Heart Failure Heart Failure GWAS
Hypertension Hypertension GWAS
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Appendicitis Associate 35693796
Carcinogenesis Associate 15161049, 37719132
Colorectal Neoplasms Associate 37719132
Fetal Growth Retardation Inhibit 16436665, 20008130
Graves Disease Associate 22014209
Hematologic Neoplasms Associate 37719132
Hernias Diaphragmatic Congenital Associate 20799323
Leukemia Myeloid Acute Associate 1375114, 31825998
Lymphoma Large B Cell Diffuse Associate 31141539
Neoplasms Associate 24067365