HLF (HLF transcription factor, PAR bZIP family member)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 3131
Gene name HLF transcription factor, PAR bZIP family member
Gene symbol HLF
Synonyms (NCBI Gene)
-
Chromosome 17
Chromosome location 17q22
Summary This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to
miRNA miRNA information provided by mirtarbase database.
274
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (274)
miRTarBase ID miRNA Experiments Reference
MIRT715185 hsa-miR-29a-5p HITS-CLIP 19536157
MIRT612902 hsa-miR-8485 HITS-CLIP 23313552
MIRT612901 hsa-miR-603 HITS-CLIP 23313552
MIRT702941 hsa-miR-374c-3p HITS-CLIP 23313552
MIRT612900 hsa-miR-600 HITS-CLIP 23313552
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
26
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (26)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 8065331
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
142385 4977 ENSG00000108924
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q16534
Protein name Hepatic leukemia factor
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 224 → 277 Basic region leucine zipper Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver; lower levels in lung and kidney.
Sequence 
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL
Sequence length 295
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Prostate cancer Uncertain significance rs193920793 RCV000149126
Show/Hide Text Mining Associations (24)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33612479, 33979320, 35205284, 40124619
Breast Neoplasms Associate 39201344
Carcinoma Hepatocellular Associate 23991075
Carcinoma Renal Cell Associate 33099483
Chromosome 17 trisomy Associate 1516826
Chromosome Disorders Associate 32245383
Colorectal Neoplasms Associate 28402947
Glioma Inhibit 33578515
Inflammation Inhibit 37868991
Leukemia Associate 17379095, 31735627, 8639829