Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3131
Gene name Gene Name - the full gene name approved by the HGNC.
HLF transcription factor, PAR bZIP family member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HLF
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q22
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT715185 hsa-miR-29a-5p HITS-CLIP 19536157
MIRT612902 hsa-miR-8485 HITS-CLIP 23313552
MIRT612901 hsa-miR-603 HITS-CLIP 23313552
MIRT702941 hsa-miR-374c-3p HITS-CLIP 23313552
MIRT612900 hsa-miR-600 HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA 21873635
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
GO:0001228 Function DNA-binding transcription activator activity, RNA polymerase II-specific IDA 8065331
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142385 4977 ENSG00000108924
Protein
UniProt ID Q16534
Protein name Hepatic leukemia factor
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07716 bZIP_2 224 277 Basic region leucine zipper Coiled-coil
Tissue specificity TISSUE SPECIFICITY: Highly expressed in liver; lower levels in lung and kidney.
Sequence
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP
QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA
PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA
DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK
RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKE
LGKCKNILAKYEARHGPL
Sequence length 295
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Burkitt`s lymphoma Burkitt Lymphoma rs28933407, rs121918683, rs121918684 20519628
Lymphoblastic leukemia Childhood Acute Lymphoblastic Leukemia, L2 Acute Lymphoblastic Leukemia, Precursor B-cell lymphoblastic leukemia, Precursor B-cell acute lymphoblastic leukemia, Precursor Cell Lymphoblastic Leukemia Lymphoma rs387906351, rs104894562, rs398122513, rs398122840, rs1057524466, rs1064796115, rs1064795660, rs1064793129, rs1064796227, rs1567887558, rs1161194345, rs1597558200, rs1406320425, rs1597566470, rs1597566699
View all (13 more)
26214592, 20519628
Unknown
Disease term Disease name Evidence References Source
Mental depression Unipolar Depression, Major Depressive Disorder 25880836 ClinVar
Bipolar Disorder Bipolar Disorder GWAS
Gout Gout GWAS
Heart Failure Heart Failure GWAS
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 33612479, 33979320, 35205284, 40124619
Breast Neoplasms Associate 39201344
Carcinoma Hepatocellular Associate 23991075
Carcinoma Renal Cell Associate 33099483
Chromosome 17 trisomy Associate 1516826
Chromosome Disorders Associate 32245383
Colorectal Neoplasms Associate 28402947
Glioma Inhibit 33578515
Inflammation Inhibit 37868991
Leukemia Associate 17379095, 31735627, 8639829