Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30818
Gene name Gene Name - the full gene name approved by the HGNC.
Potassium voltage-gated channel interacting protein 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KCNIP3
Synonyms (NCBI Gene) Gene synonyms aliases
CSEN, DREAM, KCHIP3
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q11.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of this family are small calcium binding proteins containing EF-hand-like domai
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT608434 hsa-miR-3942-5p HITS-CLIP 23824327
MIRT608433 hsa-miR-4703-5p HITS-CLIP 23824327
MIRT608432 hsa-miR-3908 HITS-CLIP 23824327
MIRT667780 hsa-miR-26b-3p HITS-CLIP 23824327
MIRT608428 hsa-miR-6867-5p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 10078534
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IDA 10078534
GO:0001227 Function DNA-binding transcription repressor activity, RNA polymerase II-specific IDA 10078534
GO:0005244 Function Voltage-gated ion channel activity IEA
GO:0005267 Function Potassium channel activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604662 15523 ENSG00000115041
Protein
UniProt ID Q9Y2W7
Protein name Calsenilin (A-type potassium channel modulatory protein 3) (DRE-antagonist modulator) (DREAM) (Kv channel-interacting protein 3) (KChIP3)
Protein function Calcium-dependent transcriptional repressor that binds to the DRE element of genes including PDYN and FOS. Affinity for DNA is reduced upon binding to calcium and enhanced by binding to magnesium. Seems to be involved in nociception (By similari
PDB 2E6W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13833 EF-hand_8 105 158 EF-hand domain pair Domain
PF13499 EF-hand_7 164 240 EF-hand domain pair Domain
PF00036 EF-hand_1 166 194 EF hand Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain. Widely expressed at lower levels. Expression levels are elevated in brain cortex regions affected by Alzheimer disease. {ECO:0000269|PubMed:14720210}.
Sequence
MQPAKEVTKASDGSLLGDLGHTPLSKKEGIKWQRPRLSRQALMRCCLVKWILSSTAPQGS
DSSDSELELSTVRHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQ
FFPQGDATTYAHFLFNAFDADGNGAIHFEDFVVGLSIL
LRGTVHEKLKWAFNLYDINKDG
YITKEEMLAIMKSI
YDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQ

KDENIMSSMQLFENVI
Sequence length 256
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Phase 1 - inactivation of fast Na+ channels
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Associations from Text Mining
Disease Name Relationship Type References
Alzheimer Disease Stimulate 40329537
Breast Neoplasms Associate 32977823
Carcinoma Non Small Cell Lung Associate 35058503
Carcinoma Ovarian Epithelial Associate 28031411
Chorioamnionitis Stimulate 29682558
Colorectal Neoplasms Associate 35131032
Follicular Cyst Associate 29641740
Friedreich Ataxia 1 Associate 29641740
Hereditary Breast and Ovarian Cancer Syndrome Associate 30206359
Inflammation Associate 29682558