Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
30817
Gene name Gene Name - the full gene name approved by the HGNC.
Adhesion G protein-coupled receptor E2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ADGRE2
Synonyms (NCBI Gene) Gene synonyms aliases
CD312, CD97, EMR2, VBU
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.12
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the class B seven-span transmembrane (TM7) subfamily of G-protein coupled receptors. These proteins are characterized by an extended extracellular region with a variable number of N-terminal epidermal growth factor-like domai
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs199718602 C>T Pathogenic Missense variant, coding sequence variant, non coding transcript variant, intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT754628 hsa-miR-3186-5p PAR-CLIP 23446348
MIRT754629 hsa-miR-1295b-3p PAR-CLIP 23446348
MIRT754630 hsa-miR-619-5p PAR-CLIP 23446348
MIRT754631 hsa-miR-6506-5p PAR-CLIP 23446348
MIRT754632 hsa-miR-6889-3p PAR-CLIP 23446348
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004888 Function Transmembrane signaling receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 15203201
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
606100 3337 ENSG00000127507
Protein
UniProt ID Q9UHX3
Protein name Adhesion G protein-coupled receptor E2 (EGF-like module receptor 2) (EGF-like module-containing mucin-like hormone receptor-like 2) (CD antigen CD312)
Protein function Cell surface receptor that binds to the chondroitin sulfate moiety of glycosaminoglycan chains and promotes cell attachment. Promotes granulocyte chemotaxis, degranulation and adhesion. In macrophages, promotes the release of inflammatory cytoki
PDB 2BO2 , 2BOU , 2BOX
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07645 EGF_CA 67 117 Calcium-binding EGF domain Domain
PF07645 EGF_CA 119 161 Calcium-binding EGF domain Domain
PF07645 EGF_CA 163 210 Calcium-binding EGF domain Domain
PF07645 EGF_CA 212 259 Calcium-binding EGF domain Domain
PF01825 GPS 480 523 GPCR proteolysis site, GPS, motif Motif
PF00002 7tm_2 533 774 7 transmembrane receptor (Secretin family) Family
Tissue specificity TISSUE SPECIFICITY: Expression is restricted to myeloid cells. Highest expression was found in peripheral blood leukocytes, followed by spleen and lymph nodes, with intermediate to low levels in thymus, bone marrow, fetal liver, placenta, and lung, and no
Sequence
MGGRVFLVFLAFCVWLTLPGAETQDSRGCARWCPQDSSCVNATACRCNPGFSSFSEIITT
PMETCDDINECATLSKVSCGKFSDCWNTEGSYDCVCSPGYEPVSGAKTFKNESENTCQDV
DECQQNPRLCKSYGTCVNTLGSYTCQCLPGFKLKPEDPKLC
TDVNECTSGQNPCHSSTHC
LNNVGSYQCRCRPGWQPIPGSPNGPNNTVC
EDVDECSSGQHQCDSSTVCFNTVGSYSCRC
RPGWKPRHGIPNNQKDTVC
EDMTFSTWTPPPGVHSQTLSRFFDKVQDLGRDYKPGLANNT
IQSILQALDELLEAPGDLETLPRLQQHCVASHLLDGLEDVLRGLSKNLSNGLLNFSYPAG
TELSLEVQKQVDRSVTLRQNQAVMQLDWNQAQKSGDPGPSVVGLVSIPGMGKLLAEAPLV
LEPEKQMLLHETHQGLLQDGSPILLSDVISAFLSNNDTQNLSSPVTFTFSHRSVIPRQKV
LCVFWEHGQNGCGHWATTGCSTIGTRDTSTICRCTHLSSFAVL
MAHYDVQEEDPVLTVIT
YMGLSVSLLCLLLAALTFLLCKAIQNTSTSLHLQLSLCLFLAHLLFLVAIDQTGHKVLCS
IIAGTLHYLYLATLTWMLLEALYLFLTARNLTVVNYSSINRFMKKLMFPVGYGVPAVTVA
ISAASRPHLYGTPSRCWLQPEKGFIWGFLGPVCAIFSVNLVLFLVTLWILKNRLSSLNSE
VSTLRNTRMLAFKATAQLFILGCTWCLGILQVGPAARVMAYLFTIINSLQGVFI
FLVYCL
LSQQVREQYGKWSKGIRKLKTESEMHTLSSSAKADTSKPSTVN
Sequence length 823
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Class B/2 (Secretin family receptors)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Vibratory urticaria vibratory urticaria rs199718602 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Mental Depression Major depressive disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Arthritis Rheumatoid Stimulate 15693006
Communicable Diseases Associate 27905560
Esophageal Neoplasms Associate 26631031
Familial dermographism Associate 26841242, 32222457, 33488598
Flushing Associate 32222457
Hypotension Associate 32222457
Idiopathic Noncirrhotic Portal Hypertension Associate 27905560
IgA Vasculitis Associate 15693006
Infections Stimulate 27905560
Inflammation Associate 22035891, 33488598