HDC (histidine decarboxylase)

Gene
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3067
Gene name Gene Name - the full gene name approved by the HGNC.
Histidine decarboxylase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HDC
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q21.2
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the group II decarboxylase family and forms a homodimer that converts L-histidine to histamine in a pyridoxal phosphate dependent manner. Histamine regulates several physiologic processes, including neurotransmission, gastric
SNPs SNP information provided by dbSNP.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
SNP ID Visualize variation Clinical significance Consequence
rs267606861 C>T Pathogenic Coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
miRTarBase ID miRNA Experiments Reference
MIRT2241373 hsa-miR-4643 CLIP-seq
MIRT2241374 hsa-miR-466 CLIP-seq
MIRT2241375 hsa-miR-4789-3p CLIP-seq
Transcription factors
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(3)
Transcription factor Regulation Reference
HDAC7 Repression 17827213
KAT5 Repression 17827213
KLF4 Repression 14670968;17827213
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(15)
GO ID Ontology Definition Evidence Reference
GO:0001694 Process Histamine biosynthetic process IBA 21873635
GO:0001694 Process Histamine biosynthetic process IDA 22767596
GO:0001694 Process Histamine biosynthetic process IEA
GO:0001694 Process Histamine biosynthetic process TAS
GO:0004398 Function Histidine decarboxylase activity IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
142704 4855 ENSG00000140287
Protein
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P19113
Protein name Histidine decarboxylase (HDC) (EC 4.1.1.22)
Protein function Catalyzes the biosynthesis of histamine from histidine.
PDB 4E1O , 7EIW , 7EIX , 7EIY
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00282 Pyridoxal_deC 36 → 414 Pyridoxal-dependent decarboxylase conserved domain Domain
Sequence 
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV
Sequence length 662
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Histidine metabolism
Metabolic pathways 		  Histidine catabolism
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (3)
Causal
Disease term Disease name dbSNP ID References
Attention deficit hyperactivity disorder Attention deficit hyperactivity disorder rs786205019
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Tourette syndrome Gilles de la Tourette syndrome, NON RARE IN EUROPE: Tourette syndrome rs193302861, rs191284403, rs267606861
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Dementia Dementia GWAS
Show/Hide Text Mining Associations (37)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 39735553
Anxiety Disorders Associate 36292569
Asthma Associate 32460303, 33878997, 37271320
Breast Neoplasms Associate 24835231
Carcinoma Hepatocellular Associate 26356417
Carcinoma Neuroendocrine Associate 16517981
Carcinoma Small Cell Associate 12000707
Chronic Urticaria Associate 16297195
Colorectal Neoplasms Associate 23239191, 28402947
Complex Regional Pain Syndromes Associate 24244504