Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3061
Gene name Gene Name - the full gene name approved by the HGNC.	Hypocretin receptor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HCRTR1
Synonyms (NCBI Gene) Gene synonyms aliases	ORXR1, OX1R, OXR1
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p35.2
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor tha

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018468	hsa-miR-335-5p	Microarray	18185580
MIRT1042241	hsa-miR-3124-3p	CLIP-seq
MIRT1042242	hsa-miR-3125	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq
MIRT1042244	hsa-miR-3184	CLIP-seq
MIRT1042245	hsa-miR-3916	CLIP-seq
MIRT1042246	hsa-miR-423-5p	CLIP-seq
MIRT1042247	hsa-miR-511	CLIP-seq
MIRT1042248	hsa-miR-520a-5p	CLIP-seq
MIRT1042249	hsa-miR-525-5p	CLIP-seq
MIRT1042250	hsa-miR-587	CLIP-seq
MIRT1042251	hsa-miR-626	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq

Show/Hide all(16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005515	Function	Protein binding	IPI	28717967
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IDA	26950369
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007218	Process	Neuropeptide signaling pathway	IBA	21873635
GO:0007218	Process	Neuropeptide signaling pathway	IDA	26950369
GO:0007268	Process	Chemical synaptic transmission	TAS	9491897
GO:0007631	Process	Feeding behavior	IEA
GO:0016499	Function	Orexin receptor activity	IDA	26950369
GO:0017046	Function	Peptide hormone binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	26950369
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

MIM	HGNC	e!Ensembl
602392	4848	ENSG00000121764

Protein

UniProt ID

O43613

Protein name

Orexin/Hypocretin receptor type 1 (Hypocretin receptor type 1) (Orexin receptor type 1) (Ox-1-R) (Ox1-R) (Ox1R)

Protein function

Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide (PubMed:26950369, PubMed:9491897). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:26950369, Pu

PDB

4ZJ8 , 4ZJC , 6TO7 , 6TOD , 6TOS , 6TOT , 6TP3 , 6TP4 , 6TP6 , 6TQ4 , 6TQ6 , 6TQ7 , 6TQ9 , 6V9S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	63 → 358	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
TTVLP

Sequence length

425

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Hormone signaling		Orexin and neuropeptides FF and QRFP bind to their respective receptors G alpha (q) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	15978554, 17999203

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder	21377495, 22617356	ClinVar
Hypoalbuminemia	Hypoalbuminemia		GWAS

Show/Hide Text Mining Associations (10)

Disease Name	Relationship Type	References
Associations from Text Mining
Agoraphobia	Associate	30718541
Anxiety	Associate	30718541
Hepatitis B	Inhibit	31106596
Migraine Disorders	Associate	21344296
Migraine without Aura	Associate	21344296
Myalgia	Associate	30718541
Neurologic Manifestations	Associate	38191899
Obesity	Associate	27421018
Panic Disorder	Associate	30718541
Sleep Wake Disorders	Associate	33568662

HCRTR1 (hypocretin receptor 1)