HCRTR1 (hypocretin receptor 1)

Gene

• Entrez ID: 3061
• Gene name: Hypocretin receptor 1
• Gene symbol: HCRTR1
• Synonyms (NCBI Gene): ORXR1, OX1R, OXR1
• Chromosome: 1
• Chromosome location: 1p35.2
• Summary: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor tha

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018468	hsa-miR-335-5p	Microarray	18185580
MIRT1042241	hsa-miR-3124-3p	CLIP-seq
MIRT1042242	hsa-miR-3125	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq
MIRT1042244	hsa-miR-3184	CLIP-seq
MIRT1042245	hsa-miR-3916	CLIP-seq
MIRT1042246	hsa-miR-423-5p	CLIP-seq
MIRT1042247	hsa-miR-511	CLIP-seq
MIRT1042248	hsa-miR-520a-5p	CLIP-seq
MIRT1042249	hsa-miR-525-5p	CLIP-seq
MIRT1042250	hsa-miR-587	CLIP-seq
MIRT1042251	hsa-miR-626	CLIP-seq
MIRT1042243	hsa-miR-3164	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9491897
GO:0005515	Function	Protein binding	IPI	31668922
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26950369
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9491897
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	26950369
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	TAS	9491897
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	9491897
GO:0007631	Process	Feeding behavior	IEA
GO:0007631	Process	Feeding behavior	TAS	9491897
GO:0016020	Component	Membrane	IEA
GO:0016499	Function	Orexin receptor activity	IDA	26950369
GO:0016499	Function	Orexin receptor activity	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0045202	Component	Synapse	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IDA	26950369
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA

Other IDs

• MIM: 602392
• HGNC: 4848
• e!Ensembl: ENSG00000121764

Protein

• UniProt ID: O43613
• Protein name: Orexin/Hypocretin receptor type 1 (Hypocretin receptor type 1) (Orexin receptor type 1) (Ox-1-R) (Ox1-R) (Ox1R)
• Protein function: Moderately selective excitatory receptor for orexin-A and, with a lower affinity, for orexin-B neuropeptide (PubMed:26950369, PubMed:9491897). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:26950369, Pu
• PDB: 4ZJ8, 4ZJC, 6TO7, 6TOD, 6TOS, 6TOT, 6TP3, 6TP4, 6TP6, 6TQ4, 6TQ6, 6TQ7, 6TQ9, 6V9S
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	63 → 358	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVA
  LVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCK
  VIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQA
  AVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFR
  KLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKML
  MVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNF
  LSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSV
  TTVLP

• Sequence length: 425

Pathways

KEGG:

Neuroactive ligand-receptor interaction
Hormone signaling

Reactome:

Orexin and neuropeptides FF and QRFP bind to their respective receptors
G alpha (q) signalling events