Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3038
Gene name Gene Name - the full gene name approved by the HGNC.
Hyaluronan synthase 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HAS3
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs2232228 A>C,G Drug-response Synonymous variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024770 hsa-miR-215-5p Microarray 19074876
MIRT026580 hsa-miR-192-5p Microarray 19074876
MIRT536973 hsa-miR-548ae-3p PAR-CLIP 22012620
MIRT536972 hsa-miR-548ah-3p PAR-CLIP 22012620
MIRT536971 hsa-miR-548aj-3p PAR-CLIP 22012620
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000139 Component Golgi membrane IEA
GO:0000271 Process Polysaccharide biosynthetic process IBA
GO:0000271 Process Polysaccharide biosynthetic process IEA
GO:0000271 Process Polysaccharide biosynthetic process ISS
GO:0005515 Function Protein binding IPI 20507985, 25795779, 32296183
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602428 4820 ENSG00000103044
Protein
UniProt ID O00219
Protein name Hyaluronan synthase 3 (EC 2.4.1.212) (Hyaluronate synthase 3) (Hyaluronic acid synthase 3) (HA synthase 3)
Protein function Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13641 Glyco_tranf_2_3 154 360 Domain
Sequence
MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQS
LFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVM
VVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRA
STFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGG
VGGDVQILNKYDSWISFLSSVRYWMAFNVERACQSYFGCVQCISGPLGMYRNSLLQQFLE
DWYHQKFLGSKCSFGDDRHLTNRVLSLGYRTKYTARSKCLTETPTKYLRWLNQQTRWSKS

YFREWLYNSLWFHKHHLWMTYESVVTGFFPFFLIATVIQLFYRGRIWNILLFLLTVQLVG
IIKATYACFLRGNAEMIFMSLYSLLYMSSLLPAKIFAIATINKSGWGTSGRKTIVVNFIG
LIPVSIWVAVLLGGLAYTAYCQDLFSETELAFLVSGAILYGCYWVALLMLYLAIIARRCG
KKPEQYSLAFAEV
Sequence length 553
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Hyaluronan biosynthesis and export
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Attention Deficit Hyperactivity Disorder Attention deficit hyperactivity disorder N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 37247276
Carcinogenesis Stimulate 25223521
Carcinogenesis Inhibit 25934334
Carcinoma Basal Cell Associate 26352698
Carcinoma Endometrioid Associate 20875124
Cardiomyopathies Associate 24470002, 26968791
Colorectal Neoplasms Associate 22934709, 23922913
Death Associate 26352698
Dermatitis Allergic Contact Associate 35028126
Dermatitis Atopic Associate 24658508, 31049964