Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	3026
Gene name Gene Name - the full gene name approved by the HGNC.	Hyaluronan binding protein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HABP2
Synonyms (NCBI Gene) Gene synonyms aliases	FSAP, HABP, HGFAL, NMTC5, PHBP, PHBSP
Disease Acronyms (UniProt) Disease acronyms from UniProt database	NMTC5
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q25.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis lead

Show/Hide all(35)

miRTarBase ID	miRNA	Experiments
MIRT1040310	hsa-miR-214	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040312	hsa-miR-3619-5p	CLIP-seq
MIRT1040313	hsa-miR-3646	CLIP-seq
MIRT1040314	hsa-miR-4291	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040316	hsa-miR-4786-3p	CLIP-seq
MIRT1040317	hsa-miR-4799-5p	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040319	hsa-miR-761	CLIP-seq
MIRT1040320	hsa-miR-922	CLIP-seq
MIRT1040321	hsa-miR-2467-5p	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040322	hsa-miR-331-3p	CLIP-seq
MIRT1040323	hsa-miR-3612	CLIP-seq
MIRT1040324	hsa-miR-3689d	CLIP-seq
MIRT1040325	hsa-miR-4254	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040326	hsa-miR-4308	CLIP-seq
MIRT1040327	hsa-miR-4443	CLIP-seq
MIRT1040328	hsa-miR-516b	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040329	hsa-miR-579	CLIP-seq
MIRT1040330	hsa-miR-650	CLIP-seq
MIRT1040331	hsa-miR-760	CLIP-seq
MIRT2008404	hsa-miR-19a	CLIP-seq
MIRT2008405	hsa-miR-19b	CLIP-seq
MIRT2008406	hsa-miR-3145-3p	CLIP-seq
MIRT2008407	hsa-miR-593	CLIP-seq
MIRT2450941	hsa-miR-4436b-3p	CLIP-seq
MIRT2450942	hsa-miR-4532	CLIP-seq
MIRT2450943	hsa-miR-4640-5p	CLIP-seq
MIRT2450944	hsa-miR-4685-5p	CLIP-seq
MIRT2450945	hsa-miR-4690-3p	CLIP-seq
MIRT2450946	hsa-miR-4726-5p	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA	21873635
GO:0005509	Function	Calcium ion binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	TAS	8827452
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0006508	Process	Proteolysis	IBA	21873635
GO:0006508	Process	Proteolysis	IDA	11217080
GO:0007155	Process	Cell adhesion	TAS	8827452
GO:0008233	Function	Peptidase activity	IDA	11217080

MIM	HGNC	e!Ensembl
603924	4798	ENSG00000148702

Protein

UniProt ID

Q14520

Protein name

Factor VII-activating protease (FSAP) (EC 3.4.21.-) (FVII activator) (Hepatocyte growth factor activator-like protein) (Hyaluronan-binding protein 2) (Plasma hyaluronan-binding protein) (PHBP) (Plasma hyaluronan-binding serine protease) (PHBSP) [Cleaved i

Protein function

Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly (PubMe

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00008	EGF	77 → 107	EGF-like domain	Domain
PF00008	EGF	154 → 186	EGF-like domain	Domain
PF00051	Kringle	194 → 276	Kringle domain	Domain
PF00089	Trypsin	314 → 550	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8827452}.

Sequence

MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA
AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
TQVTKFLNWIKATIKSESGF

Sequence length

560

Interactions

View interactions

Show/Hide Causal Diseases (5)

Disease term	Disease name	dbSNP ID	References
Causal
Colonic neoplasms	Malignant tumor of colon	rs267607789, rs774277300, rs781222233, rs1060502734, rs1060503333, rs1339238483
Papillary renal carcinoma	Papillary Renal Cell Carcinoma	rs5030823, rs2137087134, rs121913668, rs121913669, rs121913670, rs121913671, rs121913673, rs121913243, rs786202724
Papillary thyroid carcinoma	Papillary thyroid carcinoma	rs751409106
Thrombophilia	Thrombophilia	rs118203912, rs118203911, rs121918141, rs121918142, rs121918143, rs121918144, rs121918145, rs121918146, rs121918147, rs121918148, rs121918149, rs121918151, rs121918152, rs121918153, rs121918154 View all (56 more)
Thyroid cancer	THYROID CANCER, NONMEDULLARY, 5	rs119486096, rs104894171, rs28933406, rs11554290, rs121913364, rs797044990, rs1564566774, rs200989342	28222214, 26222560, 12578864

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Diabetes	Diabetes		GWAS

Show/Hide Text Mining Associations (36)

Disease Name	Relationship Type	References
Associations from Text Mining
Acute Coronary Syndrome	Associate	22850287
Breast Neoplasms	Associate	28402931, 29665850
Carcinoma Hepatocellular	Inhibit	24278187
Carcinoma Hepatocellular	Associate	38110372
Cardiovascular Diseases	Associate	19446554
Carotid Stenosis	Associate	15486068, 21393601
Carotid Stenosis	Stimulate	32856552
Cerebral Infarction	Stimulate	22409238
Coronary Artery Disease	Stimulate	22850287
Coronary Artery Disease	Associate	29927903
Death	Stimulate	22850287
Diabetes Mellitus	Stimulate	25370187
Inflammation	Associate	26626052, 29927903, 32856552
Insulinoma	Associate	39536727
Ischemic Attack Transient	Associate	29385837
Kashin Beck Disease	Associate	28651521
Kidney Diseases	Associate	39273271
Liver Cirrhosis	Associate	19446554, 38110372
Lupus Erythematosus Systemic	Associate	26626052
Melioidosis	Associate	25370187
Myocardial Infarction	Stimulate	22850287
Neoplasms	Associate	23100106, 23688398, 26222560, 28582436
Neoplasms	Inhibit	27530615
Neoplastic Syndromes Hereditary	Associate	26832773
Neuroendocrine Tumors	Associate	39536727
Osteoarthritis	Associate	28651521, 35538609
Ovarian Neoplasms	Associate	36978087
Respiratory Distress Syndrome	Associate	17483138
Schizophrenia	Associate	22247771
Sepsis	Associate	25370187
Stroke	Associate	21114618
Thyroid Cancer Papillary	Associate	26222560, 26745718, 26832773, 28402931
Thyroid Neoplasms	Associate	26222560, 27530615
Venous Thromboembolism	Associate	15486068, 19552680
Venous Thromboembolism	Inhibit	19552680
Venous Thrombosis	Associate	22409238

HABP2 (hyaluronan binding protein 2)