HABP2 (hyaluronan binding protein 2)

Gene

• Entrez ID: 3026
• Gene name: Hyaluronan binding protein 2
• Gene symbol: HABP2
• Synonyms (NCBI Gene): FSAP, HABP, HGFAL, NMTC5, PHBP, PHBSP
• Chromosome: 10
• Chromosome location: 10q25.3
• Summary: This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is secreted by hepatocytes and proteolytically processed to generate heavy and light chains that form the mature heterodimer. Further autoproteolysis lead

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1040310	hsa-miR-214	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040312	hsa-miR-3619-5p	CLIP-seq
MIRT1040313	hsa-miR-3646	CLIP-seq
MIRT1040314	hsa-miR-4291	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040316	hsa-miR-4786-3p	CLIP-seq
MIRT1040317	hsa-miR-4799-5p	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040319	hsa-miR-761	CLIP-seq
MIRT1040320	hsa-miR-922	CLIP-seq
MIRT1040321	hsa-miR-2467-5p	CLIP-seq
MIRT1040311	hsa-miR-3170	CLIP-seq
MIRT1040322	hsa-miR-331-3p	CLIP-seq
MIRT1040323	hsa-miR-3612	CLIP-seq
MIRT1040324	hsa-miR-3689d	CLIP-seq
MIRT1040325	hsa-miR-4254	CLIP-seq
MIRT1040315	hsa-miR-4307	CLIP-seq
MIRT1040326	hsa-miR-4308	CLIP-seq
MIRT1040327	hsa-miR-4443	CLIP-seq
MIRT1040328	hsa-miR-516b	CLIP-seq
MIRT1040318	hsa-miR-567	CLIP-seq
MIRT1040329	hsa-miR-579	CLIP-seq
MIRT1040330	hsa-miR-650	CLIP-seq
MIRT1040331	hsa-miR-760	CLIP-seq
MIRT2008404	hsa-miR-19a	CLIP-seq
MIRT2008405	hsa-miR-19b	CLIP-seq
MIRT2008406	hsa-miR-3145-3p	CLIP-seq
MIRT2008407	hsa-miR-593	CLIP-seq
MIRT2450941	hsa-miR-4436b-3p	CLIP-seq
MIRT2450942	hsa-miR-4532	CLIP-seq
MIRT2450943	hsa-miR-4640-5p	CLIP-seq
MIRT2450944	hsa-miR-4685-5p	CLIP-seq
MIRT2450945	hsa-miR-4690-3p	CLIP-seq
MIRT2450946	hsa-miR-4726-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005539	Function	Glycosaminoglycan binding	TAS	8827452
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	8827452
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IDA	11217080
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	TAS	8827452
GO:0008233	Function	Peptidase activity	IDA	11217080
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA

Other IDs

• MIM: 603924
• HGNC: 4798
• e!Ensembl: ENSG00000148702

Protein

• UniProt ID: Q14520
• Protein name: Factor VII-activating protease (FSAP) (EC 3.4.21.-) (FVII activator) (Hepatocyte growth factor activator-like protein) (Hyaluronan-binding protein 2) (Plasma hyaluronan-binding protein) (PHBP) (Plasma hyaluronan-binding serine protease) (PHBSP) [Cleaved i
• Protein function: Cleaves the alpha-chain at multiple sites and the beta-chain between 'Lys-53' and 'Lys-54' but not the gamma-chain of fibrinogen and therefore does not initiate the formation of the fibrin clot and does not cause the fibrinolysis directly (PubMe
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00008	EGF	77 → 107	EGF-like domain	Domain
  PF00008	EGF	154 → 186	EGF-like domain	Domain
  PF00051	Kringle	194 → 276	Kringle domain	Domain
  PF00089	Trypsin	314 → 550	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:8827452}.
• Sequence:

  MFARMSDLHVLLLMALVGKTACGFSLMSLLESLDPDWTPDQYDYSYEDYNQEENTSSTLT
  HAENPDWYYTEDQADPCQPNPCEHGGDCLVHGSTFTCSCLAPFSGNKCQKVQNTCKDNPC
  GRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPD
  QFKGKFCEIGSDDCYVGDGYSYRGKMNRTVNQHACLYWNSHLLLQENYNMFMEDAETHGI
  GEHNFCRNPDADEKPWCFIKVTNDKVKWEYCDVSACSAQDVAYPEESPTEPSTKLPGFDS
  CGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTISMPQGHFCGGALIHPCWVLTA
  AHCTDIKTRHLKVVLGDQDLKKEEFHEQSFRVEKIFKYSHYNERDEIPHNDIALLKLKPV
  DGHCALESKYVKTVCLPDGSFPSGSECHISGWGVTETGKGSRQLLDAKVKLIANTLCNSR
  QLYDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKDGTYYVYGIVSWGLECGKRPGVY
  TQVTKFLNWIKATIKSESGF

• Sequence length: 560

Associated diseases

Unknown
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Factor VII Marburg I Variant Thrombophilia	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	rs7080536, rs11575695, rs768924245, rs111397043, rs142936446, rs11575755, rs145550399, rs377526977, rs372640275, rs2245058, rs535456555, rs886046744, rs751515984, rs886046747, rs886046749, rs886046750, rs3740530, rs374774514, rs764289580, rs140350069, rs138864377, rs2245056, rs745979452, rs113091571, rs552422428, rs886046752, rs2240879, rs185066511, rs886046739, rs886046740, rs886046741, rs201266591, rs200597605, rs886046743, rs563491571, rs557625429, rs886046746, rs569517338, rs3740529, rs886046751, rs77529465, rs200192110, rs61867369, rs139478887, rs886046742, rs11575688, rs143492790, rs765311952, rs186172374, rs886046745, rs774153837, rs886046748, rs886046753, rs117698899, rs187029293, rs11575749, rs7086714, rs151205492, rs567136227, rs113225892, rs11575750, rs142164108, rs78201625, rs1169609462, rs956367134, rs754504728, rs1845461086, rs11575759, rs909851850, rs146758495, rs369959971, rs141394312, rs1845542116, rs1845542843, rs1237088878, rs1845543593, rs1845544260, rs570843767, rs773029226, rs1564680673, rs141433300, rs138619726, rs775968273, rs761211480, rs771345114, rs1048170723, rs1023865351, rs138944153, rs906240762, rs529487369, rs551018573, rs556202931, rs374057464, rs1845425763, rs7086974, rs184372424, rs772928232, rs771393045	RCV000286268 RCV000399909 RCV000340903 RCV000332439 RCV000278601 RCV000374086 RCV000284254 RCV000308139 RCV000274089 RCV000315252 RCV000261729 RCV000376114 RCV000349161 RCV000300970 RCV000267152 RCV000325192 RCV000330830 RCV000276918 RCV000339332 RCV000401497 RCV000399498 RCV000309209 RCV000368744 RCV000357334 RCV000288482 RCV000289965 RCV000305895 RCV000360136 RCV000306617 RCV000271133 RCV000373142 RCV000338306 RCV000369911 RCV000261272 RCV000322635 RCV000394120 RCV000392252 RCV000265934 RCV000361792 RCV000384471 RCV000295780 RCV000270195 RCV000366003 RCV000385322 RCV000344254 RCV000316525 RCV000321532 RCV000382956 RCV000348220 RCV000294193 RCV000354734 RCV000320992 RCV000330913 RCV000385416 RCV001107502 RCV001107503 RCV001103880 RCV001106838 RCV001106839 RCV001107501 RCV001103876 RCV001103878 RCV001103879 RCV001104163 RCV001104164 RCV001104165 RCV001104166 RCV001104167 RCV001106937 RCV001106939 RCV001106940 RCV001106941 RCV001107597 RCV001107598 RCV001107599 RCV001107600 RCV001107601 RCV001107602 RCV001103988 RCV001103989 RCV001104281 RCV001104282 RCV001107040 RCV001107041 RCV001107042 RCV001107043 RCV001107044 RCV001107701 RCV001104069 RCV001104070 RCV001104071 RCV001104378 RCV001107125 RCV001103877 RCV001103881 RCV001106938 RCV001103990 RCV001104280
FACTOR VII-ACTIVATING PROTEASE MARBURG I POLYMORPHISM	Conflicting classifications of pathogenicity	rs7080536	RCV000006338
HABP2-related disorder	Uncertain significance; Benign; Conflicting classifications of pathogenicity; Likely benign	rs772097319, rs111397043, rs2245058, rs3740530, rs2245056, rs113091571, rs201266591, rs36039098, rs148362361, rs770805362, rs11575750, rs78201625, rs184372424	RCV003393056 RCV003950002 RCV003977860 RCV003977858 RCV003977859 RCV003910093 RCV005355626 RCV003934035 RCV003914476 RCV003971508 RCV003945812 RCV003953475 RCV003906202
Papillary renal cell carcinoma type 1	Likely benign	rs771393045	RCV005913686
Thrombophilia due to thrombin defect	Benign; Likely benign	rs138864377, rs78201625	RCV002504050 RCV002497512
Thyroid cancer, nonmedullary, 5	Uncertain significance; Conflicting classifications of pathogenicity; Benign; Likely benign	rs2133792767, rs7080536, rs138864377, rs202025374, rs78201625	RCV002244136 RCV005364871 RCV002504050 RCV004527488 RCV002497512
THYROID CANCER, NONMEDULLARY, 5, SUSCEPTIBILITY TO	Conflicting classifications of pathogenicity	rs7080536	RCV000190487
Uterine corpus endometrial carcinoma	Likely benign	rs114206232	RCV005930029
Venous thromboembolism, susceptibility to	Conflicting classifications of pathogenicity	rs7080536	RCV000006340

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Coronary Syndrome	Associate	22850287
Breast Neoplasms	Associate	28402931, 29665850
Carcinoma Hepatocellular	Inhibit	24278187
Carcinoma Hepatocellular	Associate	38110372
Cardiovascular Diseases	Associate	19446554
Carotid Stenosis	Associate	15486068, 21393601
Carotid Stenosis	Stimulate	32856552
Cerebral Infarction	Stimulate	22409238
Coronary Artery Disease	Stimulate	22850287
Coronary Artery Disease	Associate	29927903
Death	Stimulate	22850287
Diabetes Mellitus	Stimulate	25370187
Inflammation	Associate	26626052, 29927903, 32856552
Insulinoma	Associate	39536727
Ischemic Attack Transient	Associate	29385837
Kashin Beck Disease	Associate	28651521
Kidney Diseases	Associate	39273271
Liver Cirrhosis	Associate	19446554, 38110372
Lupus Erythematosus Systemic	Associate	26626052
Melioidosis	Associate	25370187
Myocardial Infarction	Stimulate	22850287
Neoplasms	Associate	23100106, 23688398, 26222560, 28582436
Neoplasms	Inhibit	27530615
Neoplastic Syndromes Hereditary	Associate	26832773
Neuroendocrine Tumors	Associate	39536727
Osteoarthritis	Associate	28651521, 35538609
Ovarian Neoplasms	Associate	36978087
Respiratory Distress Syndrome	Associate	17483138
Schizophrenia	Associate	22247771
Sepsis	Associate	25370187
Stroke	Associate	21114618
Thyroid Cancer Papillary	Associate	26222560, 26745718, 26832773, 28402931
Thyroid Neoplasms	Associate	26222560, 27530615
Venous Thromboembolism	Associate	15486068, 19552680
Venous Thromboembolism	Inhibit	19552680
Venous Thrombosis	Associate	22409238