Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Pathways
Entrez ID	3014
Gene name	H2A.X variant histone
Gene symbol	H2AX
Synonyms (NCBI Gene)	H2A.XH2A/XH2AFX
Chromosome	11
Chromosome location	11q23.3
Summary	Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA

Show/Hide all (54)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IDA	17974976
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	30952868
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000781	Component	Chromosome, telomeric region	IDA	15149599
GO:0000785	Component	Chromatin	IEA
GO:0000786	Component	Nucleosome	IBA
GO:0000786	Component	Nucleosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0001741	Component	XY body	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	2587254
GO:0003684	Function	Damaged DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12419185, 12607005, 16377563, 16820410, 17024177, 17498979, 18001824, 18001825, 18583988, 19234442, 19338747, 20000738, 20075863, 20118229, 20159462, 20224553, 20360685, 21044950, 21293379, 21317870, 21824286, 22064073, 22157895, 22193777, 22565321, 23658700, 24981860, 25923214, 267
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11331621, 15604234, 16319397, 17974976, 19734146, 23235539
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	24507776
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005657	Component	Replication fork	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005813	Component	Centrosome	IDA	17498979
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	NAS	19234442
GO:0006310	Process	DNA recombination	IEA
GO:0006334	Process	Nucleosome assembly	NAS	2587254
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	15149599
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	27248496
GO:0007283	Process	Spermatogenesis	IEA
GO:0010212	Process	Response to ionizing radiation	NAS	19234442
GO:0016607	Component	Nuclear speck	IDA
GO:0019899	Function	Enzyme binding	IPI	19234442
GO:0030527	Function	Structural constituent of chromatin	IBA
GO:0030527	Function	Structural constituent of chromatin	IEA
GO:0031507	Process	Heterochromatin formation	IBA
GO:0035861	Component	Site of double-strand break	IDA	12419185
GO:0035861	Component	Site of double-strand break	IDA	21270334
GO:0035861	Component	Site of double-strand break	IEA
GO:0042393	Function	Histone binding	IPI	19234442
GO:0045739	Process	Positive regulation of DNA repair	NAS	19234442
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	30952868
GO:0090734	Component	Site of DNA damage	IMP	27248496
GO:0140463	Function	Chromatin-protein adaptor activity	IDA	12419185, 30952868
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	30952868
GO:1990166	Process	Protein localization to site of double-strand break	IDA	24534091
GO:1990166	Process	Protein localization to site of double-strand break	IDA	12419185, 30952868

MIM	HGNC	e!Ensembl
601772	4739	ENSG00000188486

P16104

Protein name

Histone H2AX (H2a/x) (Histone H2A.X)

Protein function

Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a cent

PDB

1YDP , 2AZM , 2D31 , 2DYP , 3SHV , 3SQD , 3SZM , 3U3Z , 6K1I , 6K1J , 6K1K , 6ZWK , 7YQK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00125	Histone	2 → 91	Core histone H2A/H2B/H3/H4	Domain
PF16211	Histone_H2A_C	92 → 126	C-terminus of histone H2A	Family

Sequence

MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY

Sequence length

143

Interactions

View interactions

	KEGG		Reactome
	ATP-dependent chromatin remodeling Necroptosis Neutrophil extracellular trap formation Alcoholism Systemic lupus erythematosus		Recognition and association of DNA glycosylase with site containing an affected purine Cleavage of the damaged purine Packaging Of Telomere Ends Formation of the beta-catenin:TCF transactivating complex PRC2 methylates histones and DNA Condensation of Prophase Chromosomes Oxidative Stress Induced Senescence Senescence-Associated Secretory Phenotype (SASP) DNA Damage/Telomere Stress Induced Senescence RMTs methylate histone arginines SIRT1 negatively regulates rRNA expression NoRC negatively regulates rRNA expression B-WICH complex positively regulates rRNA expression Transcriptional regulation by small RNAs Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3 Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks Nonhomologous End-Joining (NHEJ) Processing of DNA double-strand break ends Deposition of new CENPA-containing nucleosomes at the centromere G2/M DNA damage checkpoint RNA Polymerase I Promoter Opening RNA Polymerase I Promoter Escape RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Estrogen-dependent gene expression Amyloid fiber formation

H2AX (H2A.X variant histone)