Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
3010
Gene name Gene Name - the full gene name approved by the HGNC.
H1.6 linker histone, cluster member
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
H1-6
Synonyms (NCBI Gene) Gene synonyms aliases
H1.6, H1FT, H1t, HIST1H1T, dJ221C16.2
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6p22.2
Summary Summary of gene provided in NCBI Entrez Gene.
Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0003690 Function Double-stranded DNA binding IBA
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
142712 4720 ENSG00000187475
Protein
UniProt ID P22492
Protein name Histone H1t (Testicular H1 histone)
Protein function Testis-specific histone H1 that forms less compacted chromatin compared to other H1 histone subtypes (PubMed:26757249). Formation of more relaxed chromatin may be required to promote chromatin architecture required for proper chromosome regulati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00538 Linker_histone 41 112 linker histone H1 and H5 family Domain
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:1889752, ECO:0000269|PubMed:8175896}.
Sequence
MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVG
MSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLS
KKVIPKST
RSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQK
SPVKARASKSKLTQHHEVNVRKATSKK
Sequence length 207
Interactions View interactions
<