H1-6 (H1.6 linker histone, cluster member)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein
Entrez ID 3010
Gene name H1.6 linker histone, cluster member
Gene symbol H1-6
Synonyms (NCBI Gene)
H1.6H1FTH1tHIST1H1TdJ221C16.2
Chromosome 6
Chromosome location 6p22.2
Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene Gene ontology Other IDs Protein
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IEA
GO:0000786 Component Nucleosome IEA
GO:0003677 Function DNA binding IEA
GO:0003690 Function Double-stranded DNA binding IBA
GO:0005634 Component Nucleus HDA 21630459
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
142712 4720 ENSG00000187475
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P22492
Protein name Histone H1t (Testicular H1 histone)
Protein function Testis-specific histone H1 that forms less compacted chromatin compared to other H1 histone subtypes (PubMed:26757249). Formation of more relaxed chromatin may be required to promote chromatin architecture required for proper chromosome regulati
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00538 Linker_histone 41 → 112 linker histone H1 and H5 family Domain
Tissue specificity TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:1889752, ECO:0000269|PubMed:8175896}.
Sequence 
MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVG
MSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKST
RSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQK
SPVKARASKSKLTQHHEVNVRKATSKK
Sequence length 207
Interactions View interactions