LMCD1 (LIM and cysteine rich domains 1)

Gene

• Entrez ID: 29995
• Gene name: LIM and cysteine rich domains 1
• Gene symbol: LMCD1
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3p25.3
• Summary: This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016355	hsa-miR-193b-3p	Microarray	20304954
MIRT017807	hsa-miR-335-5p	Microarray	18185580
MIRT029419	hsa-miR-26b-5p	Microarray	19088304
MIRT047240	hsa-miR-181b-5p	CLASH	23622248
MIRT039353	hsa-miR-421	CLASH	23622248
MIRT1111501	hsa-miR-1273e	CLIP-seq
MIRT1111502	hsa-miR-3614-5p	CLIP-seq
MIRT1111503	hsa-miR-4327	CLIP-seq
MIRT1111504	hsa-miR-626	CLIP-seq
MIRT2031133	hsa-miR-298	CLIP-seq
MIRT2031134	hsa-miR-3678-3p	CLIP-seq
MIRT2261866	hsa-miR-1193	CLIP-seq
MIRT2261867	hsa-miR-1228	CLIP-seq
MIRT2261868	hsa-miR-1265	CLIP-seq
MIRT1111501	hsa-miR-1273e	CLIP-seq
MIRT2261869	hsa-miR-1307	CLIP-seq
MIRT2261870	hsa-miR-2392	CLIP-seq
MIRT1111502	hsa-miR-3614-5p	CLIP-seq
MIRT1111503	hsa-miR-4327	CLIP-seq
MIRT2261871	hsa-miR-4638-5p	CLIP-seq
MIRT1111504	hsa-miR-626	CLIP-seq
MIRT2261872	hsa-miR-651	CLIP-seq
MIRT2561814	hsa-miR-4714-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010611	Process	Regulation of cardiac muscle hypertrophy	IEA
GO:0010611	Process	Regulation of cardiac muscle hypertrophy	IMP	20026769
GO:0046872	Function	Metal ion binding	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IMP	20026769

Other IDs

• MIM: 604859
• HGNC: 6633
• e!Ensembl: ENSG00000071282

Protein

• UniProt ID: Q9NZU5
• Protein name: LIM and cysteine-rich domains protein 1 (Dyxin)
• Protein function: Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-speci
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06297	PET	116 → 200	PET Domain	Domain
  PF00412	LIM	243 → 304	LIM domain	Domain
  PF00412	LIM	308 → 364	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the heart (at protein level). Expressed in many tissues with highest abundance in skeletal muscle. {ECO:0000269|PubMed:20026769}.
• Sequence:

  MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLT
  SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
  APPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELK
  LMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVE
  YVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
  CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCS
  KSKRS

• Sequence length: 365

Pathways

Reactome:

Surfactant metabolism

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONGENITAL ANOMALY OF ESOPHAGUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE	—	CTD, GWAS catalog CTD, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MITRAL VALVE PROLAPSE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Acute Kidney Injury	Associate	26083657	★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	35000595	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Associate	36010616	★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	26491211	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Associate	26491211	★☆☆☆☆ Found in Text Mining only
Prostatitis	Associate	26491211	★☆☆☆☆ Found in Text Mining only