LMCD1 (LIM and cysteine rich domains 1)

Gene

• Entrez ID: 29995
• Gene name: LIM and cysteine rich domains 1
• Gene symbol: LMCD1
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3p25.3
• Summary: This gene encodes a member of the LIM-domain family of zinc finger proteins. The encoded protein contains an N-terminal cysteine-rich domain and two C-terminal LIM domains. The presence of LIM domains suggests involvement in protein-protein interactions.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016355	hsa-miR-193b-3p	Microarray	20304954
MIRT017807	hsa-miR-335-5p	Microarray	18185580
MIRT029419	hsa-miR-26b-5p	Microarray	19088304
MIRT047240	hsa-miR-181b-5p	CLASH	23622248
MIRT039353	hsa-miR-421	CLASH	23622248
MIRT1111501	hsa-miR-1273e	CLIP-seq
MIRT1111502	hsa-miR-3614-5p	CLIP-seq
MIRT1111503	hsa-miR-4327	CLIP-seq
MIRT1111504	hsa-miR-626	CLIP-seq
MIRT2031133	hsa-miR-298	CLIP-seq
MIRT2031134	hsa-miR-3678-3p	CLIP-seq
MIRT2261866	hsa-miR-1193	CLIP-seq
MIRT2261867	hsa-miR-1228	CLIP-seq
MIRT2261868	hsa-miR-1265	CLIP-seq
MIRT1111501	hsa-miR-1273e	CLIP-seq
MIRT2261869	hsa-miR-1307	CLIP-seq
MIRT2261870	hsa-miR-2392	CLIP-seq
MIRT1111502	hsa-miR-3614-5p	CLIP-seq
MIRT1111503	hsa-miR-4327	CLIP-seq
MIRT2261871	hsa-miR-4638-5p	CLIP-seq
MIRT1111504	hsa-miR-626	CLIP-seq
MIRT2261872	hsa-miR-651	CLIP-seq
MIRT2561814	hsa-miR-4714-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003714	Function	Transcription corepressor activity	IBA	21873635
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010611	Process	Regulation of cardiac muscle hypertrophy	IMP	20026769
GO:0044267	Process	Cellular protein metabolic process	TAS
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	IMP	20026769

Other IDs

• MIM: 604859
• HGNC: 6633
• e!Ensembl: ENSG00000071282

Protein

• UniProt ID: Q9NZU5
• Protein name: LIM and cysteine-rich domains protein 1 (Dyxin)
• Protein function: Transcriptional cofactor that restricts GATA6 function by inhibiting DNA-binding, resulting in repression of GATA6 transcriptional activation of downstream target genes. Represses GATA6-mediated trans activation of lung- and cardiac tissue-speci
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06297	PET	116 → 200	PET Domain	Domain
  PF00412	LIM	243 → 304	LIM domain	Domain
  PF00412	LIM	308 → 364	LIM domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the heart (at protein level). Expressed in many tissues with highest abundance in skeletal muscle. {ECO:0000269|PubMed:20026769}.
• Sequence:

  MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLT
  SDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEW
  APPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELK
  LMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVE
  YVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHY
  CESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCS
  KSKRS

• Sequence length: 365

Pathways

Reactome:

Surfactant metabolism

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Mitral valve prolapse	Mitral Valve Prolapse Syndrome	rs768737101	26301497

Unknown
Disease term	Disease name	Evidence	References	Source
Narcolepsy	Narcolepsy			GWAS
Ovarian cancer	Ovarian cancer	Conditional KD of IL6 in the OCCA xenograft model delays tumor growth		GWAS, CBGDA
Lung adenocarcinoma	Lung adenocarcinoma	Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors		GWAS, CBGDA
Diabetes	Diabetes			GWAS
Myopia	Myopia			GWAS
Insomnia	Insomnia			GWAS
Eosinophilia	Eosinophilia			GWAS

Associations from Text Mining
Disease Name	Relationship Type	References
Acute Kidney Injury	Associate	26083657
Carcinoma Non Small Cell Lung	Associate	35000595
Head and Neck Neoplasms	Associate	36010616
Neoplasms	Associate	26491211
Prostatic Neoplasms	Associate	26491211
Prostatitis	Associate	26491211