Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29948
Gene name Gene Name - the full gene name approved by the HGNC.	Oxidative stress induced growth inhibitor 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	OSGIN1
Synonyms (NCBI Gene) Gene synonyms aliases	BDGI, OKL38
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q23.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears

Show/Hide all(30)

miRTarBase ID	miRNA	Experiments
MIRT1206627	hsa-miR-1205	CLIP-seq
MIRT1206628	hsa-miR-1299	CLIP-seq
MIRT1206629	hsa-miR-3202	CLIP-seq
MIRT1206630	hsa-miR-4446-3p	CLIP-seq
MIRT1206631	hsa-miR-4533	CLIP-seq
MIRT1206632	hsa-miR-4782-5p	CLIP-seq
MIRT1206633	hsa-miR-516b	CLIP-seq
MIRT1206634	hsa-miR-524-3p	CLIP-seq
MIRT1206635	hsa-miR-525-3p	CLIP-seq
MIRT1206636	hsa-miR-875-3p	CLIP-seq
MIRT1206637	hsa-miR-1266	CLIP-seq
MIRT1206638	hsa-miR-2861	CLIP-seq
MIRT1206639	hsa-miR-3127-5p	CLIP-seq
MIRT1206640	hsa-miR-3183	CLIP-seq
MIRT1206641	hsa-miR-3192	CLIP-seq
MIRT1206642	hsa-miR-3664-3p	CLIP-seq
MIRT1206643	hsa-miR-3909	CLIP-seq
MIRT1206644	hsa-miR-3918	CLIP-seq
MIRT1206645	hsa-miR-4300	CLIP-seq
MIRT1206646	hsa-miR-4512	CLIP-seq
MIRT1206647	hsa-miR-4518	CLIP-seq
MIRT1206648	hsa-miR-4723-3p	CLIP-seq
MIRT1206649	hsa-miR-661	CLIP-seq
MIRT1206650	hsa-miR-920	CLIP-seq
MIRT1206651	hsa-miR-4417	CLIP-seq
MIRT1206652	hsa-miR-4753-5p	CLIP-seq
MIRT2287832	hsa-miR-450b-3p	CLIP-seq
MIRT2287833	hsa-miR-4713-3p	CLIP-seq
MIRT2287834	hsa-miR-638	CLIP-seq
MIRT2287835	hsa-miR-769-3p	CLIP-seq

Show/Hide all(13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 25640309, 31515488, 32296183
GO:0005575	Component	Cellular_component	ND
GO:0007165	Process	Signal transduction	IEA
GO:0007275	Process	Multicellular organism development	IEA
GO:0008083	Function	Growth factor activity	IBA	21873635
GO:0008083	Function	Growth factor activity	IDA	11459809
GO:0030154	Process	Cell differentiation	IEA
GO:0030308	Process	Negative regulation of cell growth	IBA	21873635
GO:0030308	Process	Negative regulation of cell growth	IDA	11459809
GO:0030334	Process	Regulation of cell migration	IMP	15569677
GO:0042127	Process	Regulation of cell population proliferation	IMP	15569677
GO:0042981	Process	Regulation of apoptotic process	IMP	15569677
GO:0043065	Process	Positive regulation of apoptotic process	IEA

MIM	HGNC	e!Ensembl
607975	30093	ENSG00000140961

Protein

UniProt ID

Q9UJX0

Protein name

Oxidative stress-induced growth inhibitor 1 (EC 1.14.13.-) (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38)

Protein function

Monooxygenase catalytic activity (PubMed:38442170). Involved in regulation of cytokinesis; promotes RHOA activity, probably acting locally at the midbody in late cytokinesis (PubMed:38442170). Monooxygenase activity is involved in stabilizing tr

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver (PubMed:11459809, PubMed:14570898). {ECO:0000269|PubMed:11459809, ECO:0000269|PubMed:14570898}.

Sequence

MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP

Sequence length

477

Interactions

View interactions

Show/Hide Unknown Diseases (4)

Disease term	Disease name	Evidence	References	Source
Unknown
Myocardial infarction	Myocardial Infarction		21211798	ClinVar
Nasopharyngeal carcinoma	Nasopharyngeal carcinoma	These data suggest that KAT7 can contribute NPC cell growth and survival through up-regulation of NPC-essential genes.	23209447	ClinVar, CBGDA
Cervical Cancer	Cervical Cancer	Our screens identified 10 miRNAs that enhance fitness of HeLa cells and have been reported to be up-regulated in cervical cancer (Table2).		GWAS, CBGDA
Diabetes	Diabetes			GWAS

Show/Hide Text Mining Associations (11)

Disease Name	Relationship Type	References
Associations from Text Mining
Atherosclerosis	Associate	24434148
Carcinogenesis	Inhibit	14570898
Carcinoma Non Small Cell Lung	Associate	37646890
Inflammation	Associate	21737788
Kidney Diseases	Associate	14570898
Kidney Neoplasms	Inhibit	14570898
Lung Neoplasms	Associate	37646890
Lymphoma Primary Effusion	Associate	25860939
Neoplasms	Inhibit	17192422, 18499678, 24434148
Neoplasms	Stimulate	37646890
Triple Negative Breast Neoplasms	Associate	38600165

OSGIN1 (oxidative stress induced growth inhibitor 1)