Gene Gene information from NCBI Gene database.
Entrez ID 29948
Gene name Oxidative stress induced growth inhibitor 1
Gene symbol OSGIN1
Synonyms (NCBI Gene)
BDGIOKL38
Chromosome 16
Chromosome location 16q23.3
Summary This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears
miRNA miRNA information provided by mirtarbase database.
30
miRTarBase ID miRNA Experiments Reference
MIRT1206627 hsa-miR-1205 CLIP-seq
MIRT1206628 hsa-miR-1299 CLIP-seq
MIRT1206629 hsa-miR-3202 CLIP-seq
MIRT1206630 hsa-miR-4446-3p CLIP-seq
MIRT1206631 hsa-miR-4533 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0004497 Function Monooxygenase activity IEA
GO:0005515 Function Protein binding IPI 25416956, 25640309, 31515488, 32296183
GO:0007165 Process Signal transduction IEA
GO:0008083 Function Growth factor activity IBA
GO:0008083 Function Growth factor activity IDA 11459809
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607975 30093 ENSG00000140961
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UJX0
Protein name Oxidative stress-induced growth inhibitor 1 (EC 1.14.13.-) (Bone marrow stromal cell-derived growth inhibitor) (BMSC-derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy-induced growth inhibitor OKL38)
Protein function Monooxygenase catalytic activity (PubMed:38442170). Involved in regulation of cytokinesis; promotes RHOA activity, probably acting locally at the midbody in late cytokinesis (PubMed:38442170). Monooxygenase activity is involved in stabilizing tr
Family and domains
Tissue specificity TISSUE SPECIFICITY: Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver (PubMed:11459809, PubMed:14570898). {ECO:0000269|PubMed:11459809, ECO:0000269|PubMed:14570898}.
Sequence
MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP
Sequence length 477
Interactions View interactions