Gene Gene information from NCBI Gene database.
Entrez ID 29842
Gene name Transcription factor CP2 like 1
Gene symbol TFCP2L1
Synonyms (NCBI Gene)
CRTR1LBP-9LBP9
Chromosome 2
Chromosome location 2q14.2
miRNA miRNA information provided by mirtarbase database.
577
miRTarBase ID miRNA Experiments Reference
MIRT024786 hsa-miR-215-5p Microarray 19074876
MIRT026438 hsa-miR-192-5p Microarray 19074876
MIRT724435 hsa-miR-4274 HITS-CLIP 19536157
MIRT724434 hsa-miR-4717-5p HITS-CLIP 19536157
MIRT531806 hsa-miR-4649-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
25
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000902 Process Cell morphogenesis IEA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609785 17925 ENSG00000115112
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZI6
Protein name Transcription factor CP2-like protein 1 (CP2-related transcriptional repressor 1) (CRTR-1) (Transcription factor LBP-9)
Protein function Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs) (PubMed:25215486, PubMed:26906118). With KLF2, acts as the major effector of self-renewal that mediates induction of pluripotency
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04516 CP2 25 240 CP2 transcription factor Family
PF18016 SAM_3 302 363 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue. {ECO:0000269|PubMed:10644752}.
Sequence
MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVK
LHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGW
RWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRK
HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQ

EKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPV
GSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFN
AIK
GRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIAN
LYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL
Sequence length 479
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Chronic kidney disease Likely pathogenic rs2104690970 RCV001849817
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Anorexia Nervosa Associate 35680849
Carcinoma Medullary Associate 37236926
Carcinoma Renal Cell Associate 20502531, 36681680
Neoplasm Metastasis Associate 19723662
Neoplasms Associate 26228058, 34092745
Ovarian Neoplasms Associate 26228058
Thyroid Cancer Papillary Inhibit 21179278
Thyroid Neoplasms Associate 34092745
Tobacco Use Disorder Associate 31294817