Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29842
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor CP2 like 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TFCP2L1
Synonyms (NCBI Gene) Gene synonyms aliases
CRTR1, LBP-9, LBP9
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q14.2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT024786 hsa-miR-215-5p Microarray 19074876
MIRT026438 hsa-miR-192-5p Microarray 19074876
MIRT724435 hsa-miR-4274 HITS-CLIP 19536157
MIRT724434 hsa-miR-4717-5p HITS-CLIP 19536157
MIRT531806 hsa-miR-4649-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000785 Component Chromatin ISA
GO:0000902 Process Cell morphogenesis IEA
GO:0000976 Function Transcription cis-regulatory region binding IEA
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609785 17925 ENSG00000115112
Protein
UniProt ID Q9NZI6
Protein name Transcription factor CP2-like protein 1 (CP2-related transcriptional repressor 1) (CRTR-1) (Transcription factor LBP-9)
Protein function Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs) (PubMed:25215486, PubMed:26906118). With KLF2, acts as the major effector of self-renewal that mediates induction of pluripotency
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04516 CP2 25 240 CP2 transcription factor Family
PF18016 SAM_3 302 363 SAM domain (Sterile alpha motif) Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue. {ECO:0000269|PubMed:10644752}.
Sequence
MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVK
LHEETLTYLNQGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGW
RWSRPGDRILDIDIPLSVGILDPRASPTQLNAVEFLWDPAKRASAFIQVHCISTEFTPRK
HGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADRKQKTDREKMEKRTAQ

EKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPV
GSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFN
AIK
GRNVRPKMTIYVCQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIAN
LYSISPQHIHRVYRQGPTGIHVVVSNEMVQNFQDESCFVLSTIKAESNDGYHIILKCGL
Sequence length 479
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Gout Gout N/A N/A GWAS
Kidney Disease Chronic kidney disease N/A N/A GWAS
Testicular Germ Cell Tumor Testicular germ cell tumor N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Anorexia Nervosa Associate 35680849
Carcinoma Medullary Associate 37236926
Carcinoma Renal Cell Associate 20502531, 36681680
Neoplasm Metastasis Associate 19723662
Neoplasms Associate 26228058, 34092745
Ovarian Neoplasms Associate 26228058
Thyroid Cancer Papillary Inhibit 21179278
Thyroid Neoplasms Associate 34092745
Tobacco Use Disorder Associate 31294817