Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2953
Gene name	Glutathione S-transferase theta 2 (gene/pseudogene)
Gene symbol	GSTT2
Synonyms (NCBI Gene)	-
Chromosome	22
Chromosome location	22q11.23
Summary	The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be div

Show/Hide all (12)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028974	hsa-miR-26b-5p	Microarray	19088304
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq
MIRT2543690	hsa-miR-2116	CLIP-seq
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2543691	hsa-miR-4255	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2543692	hsa-miR-4677-5p	CLIP-seq
MIRT2543693	hsa-miR-4758-5p	CLIP-seq
MIRT2543694	hsa-miR-4776-3p	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	1417752
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	1417752
GO:0005829	Component	Cytosol	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145

MIM	HGNC	e!Ensembl
600437	4642	ENSG00000099984

P0CG29

Protein name

Glutathione S-transferase theta-2 (EC 2.5.1.18) (GST class-theta-2)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:1417752). Has a sulfatase activity (PubMed:1417752).

PDB

4MPF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	5 → 75	Glutathione S-transferase, N-terminal domain	Domain
PF00043	GST_C	86 → 199	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells. {ECO:0000269|PubMed:8761485}.

Sequence

MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
PLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
ARIP

Sequence length

244

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Megalencephalic leukoencephalopathy with subcortical cysts 1	Likely pathogenic	rs181983734	RCV003990068

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Breast Neoplasms	Associate	29228969
Charcot Marie Tooth Disease	Associate	28860329
Colorectal Neoplasms	Associate	17250773
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	27766957
Epilepsy	Associate	27766957
Neoplasms	Associate	32577795
Obesity	Associate	19265796

GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene))