GSTT2 (glutathione S-transferase theta 2 (gene/pseudogene))

Gene

• Entrez ID: 2953
• Gene name: Glutathione S-transferase theta 2 (gene/pseudogene)
• Gene symbol: GSTT2
• Synonyms (NCBI Gene): -
• Chromosome: 22
• Chromosome location: 22q11.23
• Summary: The protein encoded by this gene, glutathione S-transferase (GST) theta 2 (GSTT2), is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be div

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028974	hsa-miR-26b-5p	Microarray	19088304
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq
MIRT2543690	hsa-miR-2116	CLIP-seq
MIRT2007353	hsa-miR-3659	CLIP-seq
MIRT2543691	hsa-miR-4255	CLIP-seq
MIRT2007354	hsa-miR-4658	CLIP-seq
MIRT2543692	hsa-miR-4677-5p	CLIP-seq
MIRT2543693	hsa-miR-4758-5p	CLIP-seq
MIRT2543694	hsa-miR-4776-3p	CLIP-seq
MIRT2007355	hsa-miR-574-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA	21873635
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0006749	Process	Glutathione metabolic process	IBA	21873635
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: 600437
• HGNC: 4642
• e!Ensembl: ENSG00000099984

Protein

• UniProt ID: P0CG29
• Protein name: Glutathione S-transferase theta-2 (EC 2.5.1.18) (GST class-theta-2)
• Protein function: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles (PubMed:1417752). Has a sulfatase activity (PubMed:1417752).
• PDB: 4MPF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02798	GST_N	5 → 75	Glutathione S-transferase, N-terminal domain	Domain
  PF00043	GST_C	86 → 199	Glutathione S-transferase, C-terminal domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed at low levels in liver. In lung, expressed at low levels in ciliated bronchiolar cells, alveolar macrophages and alveolar type II cells. {ECO:0000269|PubMed:8761485}.
• Sequence:

  MGLELFLDLVSQPSRAVYIFAKKNGIPLELRTVDLVKGQHKSKEFLQINSLGKLPTLKDG
  DFILTESSAILIYLSCKYQTPDHWYPSDLQARARVHEYLGWHADCIRGTFGIPLWVQVLG
  PLIGVQVPKEKVERNRTAMDQALQWLEDKFLGDRPFLAGQQVTLADLMALEELMQPVALG
  YELFEGRPRLAAWRGRVEAFLGAELCQEAHSIILSILEQAAKKTLPTPSPEAYQAMLLRI
  ARIP

• Sequence length: 244

Pathways

KEGG:

Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Platinum drug resistance
Pathways in cancer
Chemical carcinogenesis - DNA adducts
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis

Reactome:

Glutathione conjugation

Associated diseases

Causal
Disease term	Disease name	dbSNP ID	References
Facioscapulohumeral muscular dystrophy	Muscular Dystrophy, Facioscapulohumeral	rs387907319, rs397514623, rs1057519614, rs1598416221, rs886041918, rs886042417, rs1057519644, rs1245372794, rs1555642277, rs1555644339, rs1555647265, rs886044369, rs1568350731, rs377471712, rs2075161300, rs2075566961, rs2075161499	12868502
Hypertension	Hypertensive disease	rs13306026	22228705
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346, rs863223347, rs863223351, rs863223352, rs61734270, rs797045205, rs869312829, rs869312830, rs770913157, rs869312832, rs869312831, rs781720548, rs1262969313	19528963

Associations from Text Mining
Disease Name	Relationship Type	References
Breast Neoplasms	Associate	29228969
Charcot Marie Tooth Disease	Associate	28860329
Colorectal Neoplasms	Associate	17250773
Congenital Hereditary and Neonatal Diseases and Abnormalities	Associate	27766957
Epilepsy	Associate	27766957
Neoplasms	Associate	32577795
Obesity	Associate	19265796