Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2946
Gene name Gene Name - the full gene name approved by the HGNC.	Glutathione S-transferase mu 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GSTM2
Synonyms (NCBI Gene) Gene synonyms aliases	GST4, GSTM, GSTM2-2, GTHMUS
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

Show/Hide all(174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023220	hsa-miR-122-5p	Other	18692484
MIRT025057	hsa-miR-181a-5p	Microarray	17612493
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT1036576	hsa-miR-133a	CLIP-seq
MIRT1036577	hsa-miR-133b	CLIP-seq
MIRT1036578	hsa-miR-3125	CLIP-seq
MIRT1036579	hsa-miR-3150b-3p	CLIP-seq
MIRT1036580	hsa-miR-3185	CLIP-seq
MIRT1036581	hsa-miR-3671	CLIP-seq
MIRT1036582	hsa-miR-3916	CLIP-seq
MIRT1036583	hsa-miR-3921	CLIP-seq
MIRT1036584	hsa-miR-3928	CLIP-seq
MIRT1036585	hsa-miR-4438	CLIP-seq
MIRT1036586	hsa-miR-4493	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT1036588	hsa-miR-4653-5p	CLIP-seq
MIRT1036589	hsa-miR-4689	CLIP-seq
MIRT1036590	hsa-miR-4753-5p	CLIP-seq
MIRT1036591	hsa-miR-4755-3p	CLIP-seq
MIRT1036592	hsa-miR-4784	CLIP-seq
MIRT1036593	hsa-miR-494	CLIP-seq
MIRT1036594	hsa-miR-548ac	CLIP-seq
MIRT1036595	hsa-miR-548ae	CLIP-seq
MIRT1036596	hsa-miR-548ag	CLIP-seq
MIRT1036597	hsa-miR-548ai	CLIP-seq
MIRT1036598	hsa-miR-548aj	CLIP-seq
MIRT1036599	hsa-miR-548am	CLIP-seq
MIRT1036600	hsa-miR-548d-3p	CLIP-seq
MIRT1036601	hsa-miR-548x	CLIP-seq
MIRT1036602	hsa-miR-548z	CLIP-seq
MIRT1036603	hsa-miR-607	CLIP-seq
MIRT2007315	hsa-miR-2467-3p	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2007319	hsa-miR-3678-3p	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT2007321	hsa-miR-4267	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2388805	hsa-miR-1255a	CLIP-seq
MIRT2388806	hsa-miR-1255b	CLIP-seq
MIRT2388807	hsa-miR-15a	CLIP-seq
MIRT2388808	hsa-miR-15b	CLIP-seq
MIRT2388809	hsa-miR-16	CLIP-seq
MIRT2388810	hsa-miR-195	CLIP-seq
MIRT2388811	hsa-miR-214	CLIP-seq
MIRT2388812	hsa-miR-3619-5p	CLIP-seq
MIRT2388813	hsa-miR-424	CLIP-seq
MIRT2388814	hsa-miR-4433	CLIP-seq
MIRT2388815	hsa-miR-4459	CLIP-seq
MIRT2388816	hsa-miR-4768-3p	CLIP-seq
MIRT2388817	hsa-miR-4772-5p	CLIP-seq
MIRT2388818	hsa-miR-497	CLIP-seq
MIRT2388819	hsa-miR-761	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682158	hsa-miR-1224-3p	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2682159	hsa-miR-1260	CLIP-seq
MIRT2682160	hsa-miR-1260b	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2682161	hsa-miR-1280	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2682162	hsa-miR-151-5p	CLIP-seq
MIRT2682163	hsa-miR-151b	CLIP-seq
MIRT2682164	hsa-miR-1827	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2682165	hsa-miR-3176	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2682166	hsa-miR-3612	CLIP-seq
MIRT2682167	hsa-miR-3665	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2682168	hsa-miR-3922-3p	CLIP-seq
MIRT2682169	hsa-miR-3922-5p	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT2682170	hsa-miR-4695-5p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2682171	hsa-miR-4736	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682172	hsa-miR-650	CLIP-seq
MIRT2682173	hsa-miR-764	CLIP-seq
MIRT2682174	hsa-miR-940	CLIP-seq

Show/Hide all(31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA	21873635
GO:0004364	Function	Glutathione transferase activity	IDA	2034681, 8373352, 16549767
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0005102	Function	Signaling receptor binding	IPI	22406107
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	24965446, 28514442, 32296183
GO:0005737	Component	Cytoplasm	IDA	2034681, 8373352
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006749	Process	Glutathione metabolic process	IBA	21873635
GO:0006749	Process	Glutathione metabolic process	IDA	2034681, 8373352, 16549767
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	17023043
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IC	17023043, 22406107
GO:0014809	Process	Regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion	IC	17023043
GO:0016529	Component	Sarcoplasmic reticulum	IDA	22406107
GO:0018916	Process	Nitrobenzene metabolic process	IDA	2034681, 8373352
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	2034681, 8373352, 16549767
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	2034681, 8373352
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0045171	Component	Intercellular bridge	IDA
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0055119	Process	Relaxation of cardiac muscle	TAS	21323602
GO:0060315	Process	Negative regulation of ryanodine-sensitive calcium-release channel activity	IDA	17023043, 22406107
GO:0060316	Process	Positive regulation of ryanodine-sensitive calcium-release channel activity	IDA	17023043
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070458	Process	Cellular detoxification of nitrogen compound	IDA	2034681, 8373352
GO:0071313	Process	Cellular response to caffeine	IDA	22406107
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1901687	Process	Glutathione derivative biosynthetic process	TAS

MIM	HGNC	e!Ensembl
138380	4634	ENSG00000213366

Protein

UniProt ID

P28161

Protein name

Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (GSTM2-2)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). {ECO:0000269|PubMed:16549767, ECO:0000269|PubMed:21046276

PDB

1HNA , 1HNB , 1HNC , 1XW5 , 1YKC , 2AB6 , 2C4J , 2GTU , 3GTU , 3GUR , 5HWL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain
PF00043	GST_C	104 → 192	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Muscle.

Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Sequence length

218

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	29059683
Lung carcinoma	Non-Small Cell Lung Carcinoma	rs1805076, rs121909071, rs121913530, rs112445441, rs121913529, rs121913535, rs121913297, rs121913279, rs104886003, rs397516975, rs11554290, rs121913364, rs121913351, rs121913369, rs121913355 View all (44 more)	19900515
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	22874804

Show/Hide Unknown Diseases (2)

Disease term	Disease name	Evidence	Source
Unknown
Breast cancer	Breast cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Restless Legs Syndrome	Restless Legs Syndrome		GWAS

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	38111060, 40179422
Adrenocortical Carcinoma	Associate	34918636
Barrett Esophagus	Associate	18664505
Breast Neoplasms	Associate	26510686, 40508038
Carcinoma Hepatocellular	Associate	20165882
Carcinoma Intraductal Noninfiltrating	Associate	29528252
Carcinoma Non Small Cell Lung	Associate	21246532
Carcinoma Squamous Cell	Associate	40179422
Cholestasis	Inhibit	25798860
Cirrhosis Familial	Associate	33978213
Colonic Neoplasms	Associate	32539715
Colorectal Neoplasms	Associate	18630481, 27566576
Depressive Disorder	Associate	40508038
Drug Related Side Effects and Adverse Reactions	Associate	23675469
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30032483
Kidney Failure Chronic	Associate	27498857
Leukemia Myeloid Acute	Associate	23725116
Lung Neoplasms	Associate	21246532
Meningeal Neoplasms	Associate	26580399
Neoplasms	Associate	18664505, 29528252, 35729618
Nervous System Diseases	Associate	36939926
Neurodegenerative Diseases	Associate	9164836
Non alcoholic Fatty Liver Disease	Associate	20805291
Pain	Associate	36939926
Peripheral Nervous System Diseases	Associate	36939926
Precancerous Conditions	Associate	26580399
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12492580
Rectal Neoplasms	Associate	27566576
Squamous Cell Carcinoma of Head and Neck	Associate	25612142
Urinary Bladder Neoplasms	Associate	31646988
Urinary Bladder Neoplasms	Inhibit	35594716

GSTM2 (glutathione S-transferase mu 2)