Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2946
Gene name	Glutathione S-transferase mu 2
Gene symbol	GSTM2
Synonyms (NCBI Gene)	GST4GSTMGSTM2-2GTHMUS
Chromosome	1
Chromosome location	1p13.3
Summary	Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

174

Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023220	hsa-miR-122-5p	Other	18692484
MIRT025057	hsa-miR-181a-5p	Microarray	17612493
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT1036576	hsa-miR-133a	CLIP-seq
MIRT1036577	hsa-miR-133b	CLIP-seq
MIRT1036578	hsa-miR-3125	CLIP-seq
MIRT1036579	hsa-miR-3150b-3p	CLIP-seq
MIRT1036580	hsa-miR-3185	CLIP-seq
MIRT1036581	hsa-miR-3671	CLIP-seq
MIRT1036582	hsa-miR-3916	CLIP-seq
MIRT1036583	hsa-miR-3921	CLIP-seq
MIRT1036584	hsa-miR-3928	CLIP-seq
MIRT1036585	hsa-miR-4438	CLIP-seq
MIRT1036586	hsa-miR-4493	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT1036588	hsa-miR-4653-5p	CLIP-seq
MIRT1036589	hsa-miR-4689	CLIP-seq
MIRT1036590	hsa-miR-4753-5p	CLIP-seq
MIRT1036591	hsa-miR-4755-3p	CLIP-seq
MIRT1036592	hsa-miR-4784	CLIP-seq
MIRT1036593	hsa-miR-494	CLIP-seq
MIRT1036594	hsa-miR-548ac	CLIP-seq
MIRT1036595	hsa-miR-548ae	CLIP-seq
MIRT1036596	hsa-miR-548ag	CLIP-seq
MIRT1036597	hsa-miR-548ai	CLIP-seq
MIRT1036598	hsa-miR-548aj	CLIP-seq
MIRT1036599	hsa-miR-548am	CLIP-seq
MIRT1036600	hsa-miR-548d-3p	CLIP-seq
MIRT1036601	hsa-miR-548x	CLIP-seq
MIRT1036602	hsa-miR-548z	CLIP-seq
MIRT1036603	hsa-miR-607	CLIP-seq
MIRT2007315	hsa-miR-2467-3p	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2007319	hsa-miR-3678-3p	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT2007321	hsa-miR-4267	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2388805	hsa-miR-1255a	CLIP-seq
MIRT2388806	hsa-miR-1255b	CLIP-seq
MIRT2388807	hsa-miR-15a	CLIP-seq
MIRT2388808	hsa-miR-15b	CLIP-seq
MIRT2388809	hsa-miR-16	CLIP-seq
MIRT2388810	hsa-miR-195	CLIP-seq
MIRT2388811	hsa-miR-214	CLIP-seq
MIRT2388812	hsa-miR-3619-5p	CLIP-seq
MIRT2388813	hsa-miR-424	CLIP-seq
MIRT2388814	hsa-miR-4433	CLIP-seq
MIRT2388815	hsa-miR-4459	CLIP-seq
MIRT2388816	hsa-miR-4768-3p	CLIP-seq
MIRT2388817	hsa-miR-4772-5p	CLIP-seq
MIRT2388818	hsa-miR-497	CLIP-seq
MIRT2388819	hsa-miR-761	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682158	hsa-miR-1224-3p	CLIP-seq
MIRT2543587	hsa-miR-1252	CLIP-seq
MIRT2682159	hsa-miR-1260	CLIP-seq
MIRT2682160	hsa-miR-1260b	CLIP-seq
MIRT2543588	hsa-miR-1264	CLIP-seq
MIRT2682161	hsa-miR-1280	CLIP-seq
MIRT2543589	hsa-miR-1302	CLIP-seq
MIRT2543590	hsa-miR-130a	CLIP-seq
MIRT2543591	hsa-miR-130b	CLIP-seq
MIRT2682162	hsa-miR-151-5p	CLIP-seq
MIRT2682163	hsa-miR-151b	CLIP-seq
MIRT2682164	hsa-miR-1827	CLIP-seq
MIRT2543592	hsa-miR-1909	CLIP-seq
MIRT2007316	hsa-miR-2467-5p	CLIP-seq
MIRT2543593	hsa-miR-2861	CLIP-seq
MIRT1036566	hsa-miR-2909	CLIP-seq
MIRT2543594	hsa-miR-301a	CLIP-seq
MIRT2543595	hsa-miR-301b	CLIP-seq
MIRT2543596	hsa-miR-3119	CLIP-seq
MIRT1036567	hsa-miR-3126-5p	CLIP-seq
MIRT2007317	hsa-miR-3132	CLIP-seq
MIRT2543597	hsa-miR-3155	CLIP-seq
MIRT2543598	hsa-miR-3155b	CLIP-seq
MIRT2682165	hsa-miR-3176	CLIP-seq
MIRT2007318	hsa-miR-3188	CLIP-seq
MIRT2543599	hsa-miR-3202	CLIP-seq
MIRT2543600	hsa-miR-3591-5p	CLIP-seq
MIRT2682166	hsa-miR-3612	CLIP-seq
MIRT2682167	hsa-miR-3665	CLIP-seq
MIRT2543601	hsa-miR-3666	CLIP-seq
MIRT1036568	hsa-miR-3689a-3p	CLIP-seq
MIRT1036569	hsa-miR-3689c	CLIP-seq
MIRT2682168	hsa-miR-3922-3p	CLIP-seq
MIRT2682169	hsa-miR-3922-5p	CLIP-seq
MIRT2543602	hsa-miR-3974	CLIP-seq
MIRT2007320	hsa-miR-3975	CLIP-seq
MIRT1036570	hsa-miR-4278	CLIP-seq
MIRT2543603	hsa-miR-4295	CLIP-seq
MIRT2543604	hsa-miR-4298	CLIP-seq
MIRT2543605	hsa-miR-4473	CLIP-seq
MIRT2543606	hsa-miR-4476	CLIP-seq
MIRT2007322	hsa-miR-4512	CLIP-seq
MIRT2543607	hsa-miR-4533	CLIP-seq
MIRT2543608	hsa-miR-454	CLIP-seq
MIRT1036587	hsa-miR-4649-3p	CLIP-seq
MIRT2543609	hsa-miR-4671-3p	CLIP-seq
MIRT2682170	hsa-miR-4695-5p	CLIP-seq
MIRT1036571	hsa-miR-4709-3p	CLIP-seq
MIRT1036572	hsa-miR-4716-3p	CLIP-seq
MIRT1036573	hsa-miR-4723-5p	CLIP-seq
MIRT2543610	hsa-miR-4727-3p	CLIP-seq
MIRT1036574	hsa-miR-4728-5p	CLIP-seq
MIRT2007323	hsa-miR-4731-5p	CLIP-seq
MIRT2682171	hsa-miR-4736	CLIP-seq
MIRT2543611	hsa-miR-4747-5p	CLIP-seq
MIRT2543612	hsa-miR-484	CLIP-seq
MIRT2007324	hsa-miR-485-5p	CLIP-seq
MIRT2543613	hsa-miR-493	CLIP-seq
MIRT1036575	hsa-miR-629	CLIP-seq
MIRT2543614	hsa-miR-635	CLIP-seq
MIRT2682172	hsa-miR-650	CLIP-seq
MIRT2682173	hsa-miR-764	CLIP-seq
MIRT2682174	hsa-miR-940	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004364	Function	Glutathione transferase activity	IBA
GO:0004364	Function	Glutathione transferase activity	IDA	2034681, 8373352, 16549767
GO:0004364	Function	Glutathione transferase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IDA	16624487
GO:0005504	Function	Fatty acid binding	IPI	16624487
GO:0005515	Function	Protein binding	IPI	24965446, 28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IDA	2034681, 8373352
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IBA
GO:0006749	Process	Glutathione metabolic process	IDA	2034681, 8373352, 16549767
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0010880	Process	Regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	17023043
GO:0010881	Process	Regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IDA	17023043, 22406107
GO:0014809	Process	Regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion	IDA	17023043
GO:0016529	Component	Sarcoplasmic reticulum	IDA	22406107
GO:0016740	Function	Transferase activity	IEA
GO:0018916	Process	Nitrobenzene metabolic process	IDA	2034681, 8373352
GO:0019855	Function	Calcium channel inhibitor activity	IDA	22406107
GO:0019899	Function	Enzyme binding	IPI	8373352
GO:0042178	Process	Xenobiotic catabolic process	IDA	2034681, 8373352, 16549767
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	8373352
GO:0043295	Function	Glutathione binding	IDA	2034681, 8373352
GO:0043651	Process	Linoleic acid metabolic process	IDA	16624487
GO:0044325	Function	Transmembrane transporter binding	IPI	22406107
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	21046276
GO:0055119	Process	Relaxation of cardiac muscle	TAS	21323602
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070458	Process	Cellular detoxification of nitrogen compound	IDA	2034681, 8373352
GO:0071313	Process	Cellular response to caffeine	IDA	22406107
GO:0098869	Process	Cellular oxidant detoxification	IEA

MIM	HGNC	e!Ensembl
138380	4634	ENSG00000213366

P28161

Protein name

Glutathione S-transferase Mu 2 (EC 2.5.1.18) (GST class-mu 2) (GSTM2-2)

Protein function

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Participates in the formation of novel hepoxilin regioisomers (PubMed:21046276). {ECO:0000269|PubMed:16549767, ECO:0000269|PubMed:21046276

PDB

1HNA , 1HNB , 1HNC , 1XW5 , 1YKC , 2AB6 , 2C4J , 2GTU , 3GTU , 3GUR , 5HWL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02798	GST_N	3 → 82	Glutathione S-transferase, N-terminal domain	Domain
PF00043	GST_C	104 → 192	Glutathione S-transferase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Muscle.

Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDF
EKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

Sequence length

218

Interactions

View interactions

	KEGG		Reactome
	Glutathione metabolism Metabolism of xenobiotics by cytochrome P450 Drug metabolism - cytochrome P450 Drug metabolism - other enzymes Metabolic pathways Platinum drug resistance Pathways in cancer Chemical carcinogenesis - DNA adducts Chemical carcinogenesis - receptor activation Chemical carcinogenesis - reactive oxygen species Hepatocellular carcinoma Fluid shear stress and atherosclerosis		Glutathione conjugation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT URINARY SYSTEM NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Relationship Type	References	Evidence Score
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	38111060, 40179422	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Associate	34918636	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Associate	18664505	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Associate	26510686, 40508038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Associate	20165882	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Associate	29528252	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Non Small Cell Lung	Associate	21246532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Associate	40179422	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Inhibit	25798860	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis Familial	Associate	33978213	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Associate	32539715	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	18630481, 27566576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Associate	40508038	★★★★★ ★☆☆☆☆ Found in Text Mining only
Drug Related Side Effects and Adverse Reactions	Associate	23675469	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Associate	30032483	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Associate	27498857	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Associate	23725116	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Associate	21246532	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningeal Neoplasms	Associate	26580399	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Associate	18664505, 29528252, 35729618	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Associate	36939926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Associate	9164836	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non alcoholic Fatty Liver Disease	Associate	20805291	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain	Associate	36939926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Associate	36939926	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precancerous Conditions	Associate	26580399	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	12492580	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Associate	27566576	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Associate	25612142	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Associate	31646988	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Inhibit	35594716	★★★★★ ★☆☆☆☆ Found in Text Mining only

GSTM2 (glutathione S-transferase mu 2)