Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2925
Gene name Gene Name - the full gene name approved by the HGNC.	Gastrin releasing peptide receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRPR
Synonyms (NCBI Gene) Gene synonyms aliases	BB2, BB2R, BRS2
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050741	hsa-miR-17-3p	CLASH	23622248
MIRT1035462	hsa-miR-4421	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2239524	hsa-miR-129-5p	CLIP-seq
MIRT2239525	hsa-miR-1537	CLIP-seq
MIRT2239526	hsa-miR-3160-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239527	hsa-miR-4719	CLIP-seq
MIRT2239528	hsa-miR-513b	CLIP-seq
MIRT2239529	hsa-miR-520g	CLIP-seq
MIRT2239530	hsa-miR-520h	CLIP-seq
MIRT2239531	hsa-miR-548a-5p	CLIP-seq
MIRT2239532	hsa-miR-548aa	CLIP-seq
MIRT2239533	hsa-miR-548ab	CLIP-seq
MIRT2239534	hsa-miR-548ak	CLIP-seq
MIRT2239535	hsa-miR-548b-5p	CLIP-seq
MIRT2239536	hsa-miR-548c-5p	CLIP-seq
MIRT2239537	hsa-miR-548d-5p	CLIP-seq
MIRT2239538	hsa-miR-548h	CLIP-seq
MIRT2239539	hsa-miR-548i	CLIP-seq
MIRT2239540	hsa-miR-548j	CLIP-seq
MIRT2239541	hsa-miR-548w	CLIP-seq
MIRT2239542	hsa-miR-548y	CLIP-seq
MIRT2239543	hsa-miR-559	CLIP-seq
MIRT2239544	hsa-miR-607	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2450818	hsa-miR-3664-3p	CLIP-seq
MIRT2450819	hsa-miR-4433	CLIP-seq
MIRT2450820	hsa-miR-4459	CLIP-seq
MIRT2450821	hsa-miR-4493	CLIP-seq
MIRT2450822	hsa-miR-4768-3p	CLIP-seq
MIRT2450823	hsa-miR-510	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CREB1	Activation	18483184
ETS1	Activation	15300220

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0005887	Component	Integral component of plasma membrane	IMP	1655761
GO:0005887	Component	Integral component of plasma membrane	ISS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008188	Function	Neuropeptide receptor activity	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	1655761
GO:0035176	Process	Social behavior	ISS
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0061744	Process	Motor behavior	ISS

MIM	HGNC	e!Ensembl
305670	4609	ENSG00000126010

Protein

UniProt ID

P30550

Protein name

Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring bombesin receptor)

Protein function

Receptor for gastrin-releasing peptide (GRP) (PubMed:1655761). Signals via association with G proteins that activate a phosphatidylinositol-calcium second messenger system, resulting in Akt phosphorylation. Contributes to the regulation of food

PDB

7W3Z , 7W40 , 7W41 , 8H0Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 323	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas (PubMed:11245983). Also expressed in stomach, adrenal cortex and brain (PubMed:11245983). In brain, expressed in cells throughout the cortex (PubMed:34610277). {ECO:0000269|PubMed:11245983, ECO:0000269|PubM

Sequence

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Prostate cancer	Malignant neoplasm of prostate	rs121909139, rs121909140, rs121909141, rs121909142, rs121909143, rs606231169, rs606231170, rs137852584, rs137852578, rs137852580, rs137852581, rs137852582	17204703

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder		21254899	ClinVar

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining
Abdominal Pain	Associate	33530940
Adenocarcinoma	Associate	27542219
Bone Marrow Diseases	Associate	12569606
Breast Neoplasms	Associate	18199617, 19631337, 26251419, 27446498, 28107508, 29464003, 30645633, 31664083, 38342656
Calcinosis Cutis	Associate	28107508, 38342656
Carcinogenesis	Associate	23618860
Carcinoma	Stimulate	11981207
Carcinoma Non Small Cell Lung	Associate	12569606
Carcinoma Non Small Cell Lung	Stimulate	24377816
Carcinoma Renal Cell	Associate	16909223, 20012906
Cataract	Associate	16751613, 33246011, 37238733
Colonic Neoplasms	Associate	14747448
Colorectal Neoplasms	Associate	15890713, 16920698, 21281799, 24958816, 9366567
Crohn Disease	Associate	15452158
Drug Hypersensitivity	Associate	33530940
Duodenal Neoplasms	Associate	12220644
Gastrointestinal Neoplasms	Associate	14747448, 18483184
Gastrointestinal Stromal Tumors	Associate	16909223
Glioblastoma	Associate	29929115
Glioma	Associate	26449838
Head and Neck Neoplasms	Associate	17431120
Hypoxia	Associate	22296619, 25630799, 30867055
Irritable Bowel Syndrome	Associate	33530940
Laron Syndrome	Associate	19631337
Lung Neoplasms	Associate	12220644, 1655761, 22296774, 24377816
Lymphatic Metastasis	Associate	38342656
Microvascular Angina	Associate	17852785
Neoplasm Metastasis	Associate	18316548, 29464003, 38342656
Neoplasm Metastasis	Stimulate	31664083
Neoplasms	Associate	10638978, 12220644, 12474049, 15890713, 16688804, 16909223, 18199617, 20012906, 22296619, 24958816, 25849333, 26449838, 28107508, 30645633, 33789933, 38342656 View all (1 more)
Neoplasms	Stimulate	29084827
Neuroblastoma	Associate	11981207, 17401458, 20017961, 23155231, 23618860, 23889963, 24108003, 25630799
Obesity	Associate	28489853, 32153512
Pain	Associate	33530940
Pancreatic Neoplasms	Associate	10816627
Personality Disorders	Associate	25630799
Prostatic Neoplasms	Associate	21745389, 22296619, 24464532, 24727373, 27542219, 29084827, 29123014, 31017093, 31682594, 33789933, 39629134
Prostatic Neoplasms Castration Resistant	Associate	27542219
Prostatitis	Associate	22904677
Small Cell Lung Carcinoma	Associate	12474049, 12569606, 1310003, 22296619
Squamous Cell Carcinoma of Head and Neck	Associate	17431120
Squamous Cell Carcinoma of Head and Neck	Stimulate	22431275
Stomach Neoplasms	Associate	10912998
Triple Negative Breast Neoplasms	Associate	31664083

GRPR (gastrin releasing peptide receptor)