Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2925
Gene name Gene Name - the full gene name approved by the HGNC.	Gastrin releasing peptide receptor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRPR
Synonyms (NCBI Gene) Gene synonyms aliases	BB2, BB2R, BRS2
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xp22.2
Summary Summary of gene provided in NCBI Entrez Gene.	Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050741	hsa-miR-17-3p	CLASH	23622248
MIRT1035462	hsa-miR-4421	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2239524	hsa-miR-129-5p	CLIP-seq
MIRT2239525	hsa-miR-1537	CLIP-seq
MIRT2239526	hsa-miR-3160-5p	CLIP-seq
MIRT2007002	hsa-miR-3973	CLIP-seq
MIRT2239527	hsa-miR-4719	CLIP-seq
MIRT2239528	hsa-miR-513b	CLIP-seq
MIRT2239529	hsa-miR-520g	CLIP-seq
MIRT2239530	hsa-miR-520h	CLIP-seq
MIRT2239531	hsa-miR-548a-5p	CLIP-seq
MIRT2239532	hsa-miR-548aa	CLIP-seq
MIRT2239533	hsa-miR-548ab	CLIP-seq
MIRT2239534	hsa-miR-548ak	CLIP-seq
MIRT2239535	hsa-miR-548b-5p	CLIP-seq
MIRT2239536	hsa-miR-548c-5p	CLIP-seq
MIRT2239537	hsa-miR-548d-5p	CLIP-seq
MIRT2239538	hsa-miR-548h	CLIP-seq
MIRT2239539	hsa-miR-548i	CLIP-seq
MIRT2239540	hsa-miR-548j	CLIP-seq
MIRT2239541	hsa-miR-548w	CLIP-seq
MIRT2239542	hsa-miR-548y	CLIP-seq
MIRT2239543	hsa-miR-559	CLIP-seq
MIRT2239544	hsa-miR-607	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT1920473	hsa-miR-219-2-3p	CLIP-seq
MIRT1920474	hsa-miR-3162-5p	CLIP-seq
MIRT2239523	hsa-miR-1179	CLIP-seq
MIRT2450818	hsa-miR-3664-3p	CLIP-seq
MIRT2450819	hsa-miR-4433	CLIP-seq
MIRT2450820	hsa-miR-4459	CLIP-seq
MIRT2450821	hsa-miR-4493	CLIP-seq
MIRT2450822	hsa-miR-4768-3p	CLIP-seq
MIRT2450823	hsa-miR-510	CLIP-seq

Transcription factors

Show/Hide all(2)

Transcription factor	Regulation	Reference
CREB1	Activation	18483184
ETS1	Activation	15300220

Show/Hide all(34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	1655761
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	7838118, 8391296
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	1655761
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008188	Function	Neuropeptide receptor activity	IBA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0008188	Function	Neuropeptide receptor activity	ISS
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	1655761
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	TAS	7838118
GO:0016020	Component	Membrane	IEA
GO:0035176	Process	Social behavior	IEA
GO:0035176	Process	Social behavior	ISS
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042923	Function	Neuropeptide binding	IEA
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0061744	Process	Motor behavior	IEA
GO:0061744	Process	Motor behavior	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	IEA
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS
GO:2000987	Process	Positive regulation of behavioral fear response	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

MIM	HGNC	e!Ensembl
305670	4609	ENSG00000126010

Protein

UniProt ID

P30550

Protein name

Gastrin-releasing peptide receptor (GRP-R) (GRP-preferring bombesin receptor)

Protein function

Receptor for gastrin-releasing peptide (GRP) (PubMed:1655761). Signals via association with G proteins that activate a phosphatidylinositol-calcium second messenger system, resulting in Akt phosphorylation. Contributes to the regulation of food

PDB

7W3Z , 7W40 , 7W41 , 8H0Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	57 → 323	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas (PubMed:11245983). Also expressed in stomach, adrenal cortex and brain (PubMed:11245983). In brain, expressed in cells throughout the cortex (PubMed:34610277). {ECO:0000269|PubMed:11245983, ECO:0000269|PubM

Sequence

MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV

Sequence length

384

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Peptide ligand-binding receptors G alpha (q) signalling events

GRPR (gastrin releasing peptide receptor)