GRP (gastrin releasing peptide)

Gene

• Entrez ID: 2922
• Gene name: Gastrin releasing peptide
• Gene symbol: GRP
• Synonyms (NCBI Gene): BN, GRP-10, preproGRP, proGRP
• Chromosome: 18
• Chromosome location: 18q21.32
• Summary: This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions o

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005102	Function	Signaling receptor binding	NAS	3027901
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	8756537
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	3211139, 8756537
GO:0007165	Process	Signal transduction	NAS	3027901
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	8756537
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0034774	Component	Secretory granule lumen	ISS
GO:0035176	Process	Social behavior	IEA
GO:0036343	Process	Psychomotor behavior	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043207	Process	Response to external biotic stimulus	IEA
GO:0043303	Process	Mast cell degranulation	IEA
GO:0043303	Process	Mast cell degranulation	ISS
GO:0051970	Process	Negative regulation of transmission of nerve impulse	ISS
GO:0090277	Process	Positive regulation of peptide hormone secretion	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	IEA
GO:1903942	Process	Positive regulation of respiratory gaseous exchange	ISS
GO:2000987	Process	Positive regulation of behavioral fear response	IBA
GO:2000987	Process	Positive regulation of behavioral fear response	IEA
GO:2000987	Process	Positive regulation of behavioral fear response	ISS

Other IDs

• MIM: 137260
• HGNC: 4605
• e!Ensembl: ENSG00000134443

Protein

• UniProt ID: P07492
• Protein name: Gastrin-releasing peptide (GRP) [Cleaved into: Neuromedin-C (GRP-10) (GRP18-27)]
• Protein function: Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior (By similarity).
• PDB: 2N0B, 2N0C, 2N0D, 2N0E, 2N0F, 2N0G, 2N0H, 7W3Z, 8H0Q
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02044	Bombesin	41 → 54	Bombesin-like peptide	Family

• Sequence:

  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
  VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
  DVGSKGKVGRLSAPGSQREGRNPQLNQQ

• Sequence length: 148

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
G alpha (q) signalling events