GRP (gastrin releasing peptide)

Gene
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2922
Gene name Gene Name - the full gene name approved by the HGNC.
Gastrin releasing peptide
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRP
Synonyms (NCBI Gene) Gene synonyms aliases
BN, GRP-10, preproGRP, proGRP
Chromosome Chromosome number
18
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
18q21.32
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the bombesin-like family of gastrin-releasing peptides. The encoded preproprotein is proteolytically processed to generate two peptides, gastrin-releasing peptide and neuromedin-C. These peptides regulate numerous functions o
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(17)
GO ID Ontology Definition Evidence Reference
GO:0005102 Function Signaling receptor binding NAS 3027901
GO:0005184 Function Neuropeptide hormone activity IBA 21873635
GO:0005184 Function Neuropeptide hormone activity IDA 8756537
GO:0005515 Function Protein binding IPI 32296183
GO:0005576 Component Extracellular region TAS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
137260 4605 ENSG00000134443
Protein
Gene Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P07492
Protein name Gastrin-releasing peptide (GRP) [Cleaved into: Neuromedin-C (GRP-10) (GRP18-27)]
Protein function Stimulates the release of gastrin and other gastrointestinal hormones (By similarity). Contributes to the perception of prurient stimuli and to the transmission of itch signals in the spinal cord that promote scratching behavior (By similarity).
PDB 2N0B , 2N0C , 2N0D , 2N0E , 2N0F , 2N0G , 2N0H , 7W3Z , 8H0Q
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02044 Bombesin 41 → 54 Bombesin-like peptide Family
Sequence 
MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSS
VSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFK
DVGSKGKVGRLSAPGSQREGRNPQLNQQ
Sequence length 148
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Neuroactive ligand-receptor interaction   Peptide ligand-binding receptors
Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
G alpha (q) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (6)
Unknown
Disease term Disease name Evidence References Source
Head and neck cancer Malignant Head and Neck Neoplasm 15342401 ClinVar
Diabetes Diabetes GWAS
Pancreatic adenocarcinoma Pancreatic adenocarcinoma PDAC patients with high expression of PSMA6 having a significantly shorter overall survival rate. GWAS, CBGDA
Crohn Disease Crohn Disease GWAS
Show/Hide Text Mining Associations (61)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma Associate 22911792
Alzheimer Disease Associate 11959459, 36776063
Arthritis Psoriatic Associate 15899028
Arthritis Rheumatoid Associate 15899028, 7490114
Bone Marrow Diseases Associate 12569606
Breast Neoplasms Associate 10595936, 12111125, 19631337, 24949434, 37523391, 9888460
Calcinosis Associate 24949434
Carcinogenesis Associate 23618860
Carcinoid Tumor Associate 2823244, 3001723, 6207529
Carcinoma Neuroendocrine Associate 36503175