Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2913
Gene name Gene Name - the full gene name approved by the HGNC.	Glutamate metabotropic receptor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRM3
Synonyms (NCBI Gene) Gene synonyms aliases	GLUR3, GPRC1C, MGLUR3, mGlu3
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q21.11-q21.12
Summary Summary of gene provided in NCBI Entrez Gene.	L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe

Show/Hide all(13)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018386	hsa-miR-335-5p	Microarray	18185580
MIRT2006895	hsa-miR-300	CLIP-seq
MIRT2006896	hsa-miR-381	CLIP-seq
MIRT2006897	hsa-miR-4633-3p	CLIP-seq
MIRT2006898	hsa-miR-4666-3p	CLIP-seq
MIRT2006899	hsa-miR-889	CLIP-seq
MIRT2239416	hsa-miR-30a	CLIP-seq
MIRT2239417	hsa-miR-30b	CLIP-seq
MIRT2239418	hsa-miR-30c	CLIP-seq
MIRT2239419	hsa-miR-30d	CLIP-seq
MIRT2239420	hsa-miR-30e	CLIP-seq
MIRT2239421	hsa-miR-3607-3p	CLIP-seq
MIRT2239422	hsa-miR-3686	CLIP-seq

Show/Hide all(22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001640	Function	Adenylate cyclase inhibiting G protein-coupled glutamate receptor activity	IBA	21873635
GO:0001641	Function	Group II metabotropic glutamate receptor activity	IBA	21873635
GO:0004930	Function	G protein-coupled receptor activity	TAS	8840013
GO:0005246	Function	Calcium channel regulator activity	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	8840013
GO:0007196	Process	Adenylate cyclase-inhibiting G protein-coupled glutamate receptor signaling pathway	IEA
GO:0007216	Process	G protein-coupled glutamate receptor signaling pathway	IBA	21873635
GO:0007268	Process	Chemical synaptic transmission	TAS	8840013
GO:0008066	Function	Glutamate receptor activity	TAS	8840013
GO:0010467	Process	Gene expression	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0030424	Component	Axon	ISS
GO:0043197	Component	Dendritic spine	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IBA	21873635
GO:0097110	Function	Scaffold protein binding	ISS
GO:0097449	Component	Astrocyte projection	ISS
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099055	Component	Integral component of postsynaptic membrane	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA

MIM	HGNC	e!Ensembl
601115	4595	ENSG00000198822

Protein

UniProt ID

Q14832

Protein name

Metabotropic glutamate receptor 3 (mGluR3)

Protein function

G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate

PDB

3SM9 , 4XAR , 5CNK , 5CNM , 6B7H , 7WI6 , 7WI8 , 7WIH , 8JCU , 8JCV , 8JCW , 8JCX , 8JCY , 8JCZ , 8JD0 , 8JD1 , 8JD2 , 8JD3 , 9II2 , 9II3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01094	ANF_receptor	67 → 475	Receptor family ligand binding region	Family
PF07562	NCD3G	505 → 555	Nine Cysteines Domain of family 3 GPCR	Family
PF00003	7tm_3	588 → 825	7 transmembrane sweet-taste receptor of 3 GCPR	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain cortex, thalamus, subthalamic nucleus, substantia nigra, hypothalamus, hippocampus, corpus callosum, caudate nucleus and amygdala. {ECO:0000269|PubMed:8840013}.

Sequence

MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL

Sequence length

879

Interactions

View interactions

	KEGG		Reactome
	Phospholipase D signaling pathway Neuroactive ligand-receptor interaction Glutamatergic synapse Cocaine addiction		G alpha (i) signalling events Class C/3 (Metabotropic glutamate/pheromone receptors)

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Epilepsy	Epilepsy, Temporal Lobe, Uncinate Epilepsy, Epilepsy, Benign Psychomotor, Childhood, Epilepsy, Lateral Temporal	rs113994140, rs28937874, rs1589762127, rs104894166, rs28939075, rs2134001459, rs104894167, rs119488099, rs119488100, rs387906420, rs121917752, rs121918622, rs281865564, rs387907313, rs397514670 View all (165 more)	18804094
Melanoma	melanoma	rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340 View all (64 more)	21946352, 22842228
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	28540026, 30285260, 25056061, 18256595, 31268507, 28991256, 31374203, 26198764, 29483656

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Evidence	Source
Unknown
Seborrheic dermatitis	Seborrheic dermatitis		GWAS
Asthma	Asthma		GWAS
Neuroticism	Neuroticism		GWAS
Breast Cancer	Breast Cancer	Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients	GWAS, CBGDA
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (20)

Disease Name	Relationship Type	References
Associations from Text Mining
Alzheimer Disease	Associate	34981809
Amyotrophic Lateral Sclerosis	Associate	31925813
Amyotrophic lateral sclerosis 1	Associate	31925813
Attention Deficit Disorder with Hyperactivity	Associate	28452824
Autism Spectrum Disorder	Associate	21996756
Bipolar Disorder	Associate	16380905, 27063557
Breast Neoplasms	Associate	28615627, 34623384, 34920184
Carcinoma Renal Cell	Associate	30488581
Cognition Disorders	Associate	21281445
Distal Myopathies	Associate	28615627
Esophageal Neoplasms	Associate	19360286
Glioblastoma	Associate	34290229
Glioma	Associate	12614329
Melanoma	Associate	21946352
Muscular Dystrophy Duchenne	Associate	28615627
Neoplasm Metastasis	Associate	28615627, 34920184
Neoplasms	Associate	33910009
Neurologic Manifestations	Associate	24682224
Psychotic Disorders	Associate	24682224
Schizophrenia	Associate	21281445

GRM3 (glutamate metabotropic receptor 3)