GRM3 (glutamate metabotropic receptor 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2913
Gene name Glutamate metabotropic receptor 3
Gene symbol GRM3
Synonyms (NCBI Gene)
GLUR3GPRC1CMGLUR3mGlu3
Chromosome 7
Chromosome location 7q21.11-q21.12
Summary L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe
miRNA miRNA information provided by mirtarbase database.
13
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (13)
miRTarBase ID miRNA Experiments Reference
MIRT018386 hsa-miR-335-5p Microarray 18185580
MIRT2006895 hsa-miR-300 CLIP-seq
MIRT2006896 hsa-miR-381 CLIP-seq
MIRT2006897 hsa-miR-4633-3p CLIP-seq
MIRT2006898 hsa-miR-4666-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
39
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (39)
GO ID Ontology Definition Evidence Reference
GO:0001641 Function Group II metabotropic glutamate receptor activity IBA
GO:0001641 Function Group II metabotropic glutamate receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 8840013
GO:0005246 Function Calcium channel regulator activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601115 4595 ENSG00000198822
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q14832
Protein name Metabotropic glutamate receptor 3 (mGluR3)
Protein function G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate
PDB 3SM9 , 4XAR , 5CNK , 5CNM , 6B7H , 7WI6 , 7WI8 , 7WIH , 8JCU , 8JCV , 8JCW , 8JCX , 8JCY , 8JCZ , 8JD0 , 8JD1 , 8JD2 , 8JD3 , 9II2 , 9II3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 67 → 475 Receptor family ligand binding region Family
PF07562 NCD3G 505 → 555 Nine Cysteines Domain of family 3 GPCR Family
PF00003 7tm_3 588 → 825 7 transmembrane sweet-taste receptor of 3 GCPR Family
Tissue specificity TISSUE SPECIFICITY: Detected in brain cortex, thalamus, subthalamic nucleus, substantia nigra, hypothalamus, hippocampus, corpus callosum, caudate nucleus and amygdala. {ECO:0000269|PubMed:8840013}.
Sequence 
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Sequence length 879
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction 		  G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
EBV-positive nodal T- and NK-cell lymphoma Likely benign rs2535194365 RCV004560301
Show/Hide Text Mining Associations (20)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34981809
Amyotrophic Lateral Sclerosis Associate 31925813
Amyotrophic lateral sclerosis 1 Associate 31925813
Attention Deficit Disorder with Hyperactivity Associate 28452824
Autism Spectrum Disorder Associate 21996756
Bipolar Disorder Associate 16380905, 27063557
Breast Neoplasms Associate 28615627, 34623384, 34920184
Carcinoma Renal Cell Associate 30488581
Cognition Disorders Associate 21281445
Distal Myopathies Associate 28615627