GRM3 (glutamate metabotropic receptor 3)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2913
Gene name Gene Name - the full gene name approved by the HGNC.
Glutamate metabotropic receptor 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GRM3
Synonyms (NCBI Gene) Gene synonyms aliases
GLUR3, GPRC1C, MGLUR3, mGlu3
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q21.11-q21.12
Summary Summary of gene provided in NCBI Entrez Gene.
L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbe
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
miRTarBase ID miRNA Experiments Reference
MIRT018386 hsa-miR-335-5p Microarray 18185580
MIRT2006895 hsa-miR-300 CLIP-seq
MIRT2006896 hsa-miR-381 CLIP-seq
MIRT2006897 hsa-miR-4633-3p CLIP-seq
MIRT2006898 hsa-miR-4666-3p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(39)
GO ID Ontology Definition Evidence Reference
GO:0001641 Function Group II metabotropic glutamate receptor activity IBA
GO:0001641 Function Group II metabotropic glutamate receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 8840013
GO:0005246 Function Calcium channel regulator activity IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
601115 4595 ENSG00000198822
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q14832
Protein name Metabotropic glutamate receptor 3 (mGluR3)
Protein function G-protein coupled receptor for glutamate. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Signaling inhibits adenylate
PDB 3SM9 , 4XAR , 5CNK , 5CNM , 6B7H , 7WI6 , 7WI8 , 7WIH , 8JCU , 8JCV , 8JCW , 8JCX , 8JCY , 8JCZ , 8JD0 , 8JD1 , 8JD2 , 8JD3 , 9II2 , 9II3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01094 ANF_receptor 67 → 475 Receptor family ligand binding region Family
PF07562 NCD3G 505 → 555 Nine Cysteines Domain of family 3 GPCR Family
PF00003 7tm_3 588 → 825 7 transmembrane sweet-taste receptor of 3 GCPR Family
Tissue specificity TISSUE SPECIFICITY: Detected in brain cortex, thalamus, subthalamic nucleus, substantia nigra, hypothalamus, hippocampus, corpus callosum, caudate nucleus and amygdala. {ECO:0000269|PubMed:8840013}.
Sequence 
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
Sequence length 879
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Glutamatergic synapse
Cocaine addiction 		  G alpha (i) signalling events
Class C/3 (Metabotropic glutamate/pheromone receptors)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Unknown Diseases (7)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Asthma Asthma N/A N/A GWAS
Breast Cancer Breast cancer N/A N/A GWAS
Epilepsy Epilepsy N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Show/Hide Text Mining Associations (20)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Alzheimer Disease Associate 34981809
Amyotrophic Lateral Sclerosis Associate 31925813
Amyotrophic lateral sclerosis 1 Associate 31925813
Attention Deficit Disorder with Hyperactivity Associate 28452824
Autism Spectrum Disorder Associate 21996756
Bipolar Disorder Associate 16380905, 27063557
Breast Neoplasms Associate 28615627, 34623384, 34920184
Carcinoma Renal Cell Associate 30488581
Cognition Disorders Associate 21281445
Distal Myopathies Associate 28615627