Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein
Entrez ID	29128
Gene name	Ubiquitin like with PHD and ring finger domains 1
Gene symbol	UHRF1
Synonyms (NCBI Gene)	ICBP90Np95RNF106TDRD22hNP95hUHRF1huNp95
Chromosome	19
Chromosome location	19p13.3
Summary	This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001580	hsa-let-7b-5p	pSILAC	18668040
MIRT001324	hsa-miR-1-3p	pSILAC	18668040
MIRT002574	hsa-miR-124-3p	Microarray	15685193
MIRT002574	hsa-miR-124-3p	Microarray;Other	15685193
MIRT001324	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025644	hsa-miR-7-5p	Microarray	19073608
MIRT001580	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT052615	hsa-let-7a-5p	CLASH	23622248
MIRT047656	hsa-miR-10a-5p	CLASH	23622248
MIRT047494	hsa-miR-10b-5p	CLASH	23622248
MIRT025268	hsa-miR-34a-5p	CLASH	23622248
MIRT046925	hsa-miR-221-3p	CLASH	23622248
MIRT045790	hsa-miR-191-5p	CLASH	23622248
MIRT039881	hsa-miR-615-3p	CLASH	23622248
MIRT039881	hsa-miR-615-3p	CLASH	23622248
MIRT021236	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayWestern blot	23982143
MIRT021236	hsa-miR-146a-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayWestern blot	23982143
MIRT053567	hsa-miR-146b-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayWestern blot	23982143
MIRT053567	hsa-miR-146b-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayWestern blot	23982143
MIRT052615	hsa-let-7a-5p	Luciferase reporter assayqRT-PCRWestern blot	26049093
MIRT002574	hsa-miR-124-3p	Luciferase reporter assayWestern blot	26310391
MIRT002574	hsa-miR-124-3p	Luciferase reporter assayWestern blot	26310391
MIRT001580	hsa-let-7b-5p	Luciferase reporter assayWestern blottingqRT-PCR	31873045
MIRT756026	hsa-miR-520d-3p	Luciferase reporter assayWestern blottingqRT-PCRChIP-seq	35664070
MIRT1474167	hsa-miR-101	CLIP-seq
MIRT1474168	hsa-miR-1263	CLIP-seq
MIRT1474169	hsa-miR-1283	CLIP-seq
MIRT1474170	hsa-miR-1305	CLIP-seq
MIRT1474171	hsa-miR-144	CLIP-seq
MIRT1474172	hsa-miR-148a	CLIP-seq
MIRT1474173	hsa-miR-148b	CLIP-seq
MIRT1474174	hsa-miR-152	CLIP-seq
MIRT1474175	hsa-miR-3133	CLIP-seq
MIRT1474176	hsa-miR-4301	CLIP-seq
MIRT1474177	hsa-miR-4307	CLIP-seq
MIRT1474178	hsa-miR-4511	CLIP-seq
MIRT1474179	hsa-miR-548b-3p	CLIP-seq
MIRT1474180	hsa-miR-578	CLIP-seq
MIRT1474181	hsa-miR-606	CLIP-seq
MIRT1474182	hsa-miR-607	CLIP-seq
MIRT1474183	hsa-let-7a	CLIP-seq
MIRT1474184	hsa-let-7b	CLIP-seq
MIRT1474185	hsa-let-7c	CLIP-seq
MIRT1474186	hsa-let-7d	CLIP-seq
MIRT1474187	hsa-let-7e	CLIP-seq
MIRT1474188	hsa-let-7f	CLIP-seq
MIRT1474189	hsa-let-7g	CLIP-seq
MIRT1474190	hsa-let-7i	CLIP-seq
MIRT1474191	hsa-miR-1243	CLIP-seq
MIRT1474192	hsa-miR-1275	CLIP-seq
MIRT1474193	hsa-miR-1278	CLIP-seq
MIRT1474194	hsa-miR-1292	CLIP-seq
MIRT1474195	hsa-miR-1304	CLIP-seq
MIRT1474170	hsa-miR-1305	CLIP-seq
MIRT1474196	hsa-miR-135a	CLIP-seq
MIRT1474197	hsa-miR-135b	CLIP-seq
MIRT1474198	hsa-miR-1827	CLIP-seq
MIRT1474199	hsa-miR-188-5p	CLIP-seq
MIRT1474200	hsa-miR-200b	CLIP-seq
MIRT1474201	hsa-miR-200c	CLIP-seq
MIRT1474202	hsa-miR-202	CLIP-seq
MIRT1474203	hsa-miR-2909	CLIP-seq
MIRT1474204	hsa-miR-3119	CLIP-seq
MIRT1474175	hsa-miR-3133	CLIP-seq
MIRT1474205	hsa-miR-3162-5p	CLIP-seq
MIRT1474206	hsa-miR-323-3p	CLIP-seq
MIRT1474207	hsa-miR-339-5p	CLIP-seq
MIRT1474208	hsa-miR-3545-3p	CLIP-seq
MIRT1474209	hsa-miR-3646	CLIP-seq
MIRT1474210	hsa-miR-3654	CLIP-seq
MIRT1474211	hsa-miR-371-5p	CLIP-seq
MIRT1474212	hsa-miR-374c	CLIP-seq
MIRT1474213	hsa-miR-378	CLIP-seq
MIRT1474214	hsa-miR-378b	CLIP-seq
MIRT1474215	hsa-miR-378c	CLIP-seq
MIRT1474216	hsa-miR-378d	CLIP-seq
MIRT1474217	hsa-miR-378e	CLIP-seq
MIRT1474218	hsa-miR-378f	CLIP-seq
MIRT1474219	hsa-miR-378h	CLIP-seq
MIRT1474220	hsa-miR-378i	CLIP-seq
MIRT1474221	hsa-miR-3929	CLIP-seq
MIRT1474222	hsa-miR-3973	CLIP-seq
MIRT1474223	hsa-miR-422a	CLIP-seq
MIRT1474224	hsa-miR-4251	CLIP-seq
MIRT1474225	hsa-miR-4261	CLIP-seq
MIRT1474226	hsa-miR-4274	CLIP-seq
MIRT1474227	hsa-miR-4282	CLIP-seq
MIRT1474228	hsa-miR-429	CLIP-seq
MIRT1474229	hsa-miR-4299	CLIP-seq
MIRT1474177	hsa-miR-4307	CLIP-seq
MIRT1474230	hsa-miR-4419b	CLIP-seq
MIRT1474231	hsa-miR-4447	CLIP-seq
MIRT1474232	hsa-miR-4456	CLIP-seq
MIRT1474233	hsa-miR-4458	CLIP-seq
MIRT1474234	hsa-miR-4461	CLIP-seq
MIRT1474235	hsa-miR-4464	CLIP-seq
MIRT1474236	hsa-miR-4472	CLIP-seq
MIRT1474237	hsa-miR-4478	CLIP-seq
MIRT1474238	hsa-miR-4496	CLIP-seq
MIRT1474239	hsa-miR-4500	CLIP-seq
MIRT1474240	hsa-miR-4501	CLIP-seq
MIRT1474178	hsa-miR-4511	CLIP-seq
MIRT1474241	hsa-miR-4525	CLIP-seq
MIRT1474242	hsa-miR-4638-3p	CLIP-seq
MIRT1474243	hsa-miR-4665-5p	CLIP-seq
MIRT1474244	hsa-miR-4668-3p	CLIP-seq
MIRT1474245	hsa-miR-4723-5p	CLIP-seq
MIRT1474246	hsa-miR-4731-3p	CLIP-seq
MIRT1474247	hsa-miR-4748	CLIP-seq
MIRT1474248	hsa-miR-4801	CLIP-seq
MIRT1474249	hsa-miR-541	CLIP-seq
MIRT1474250	hsa-miR-548k	CLIP-seq
MIRT1474251	hsa-miR-548q	CLIP-seq
MIRT1474252	hsa-miR-553	CLIP-seq
MIRT1474253	hsa-miR-580	CLIP-seq
MIRT1474182	hsa-miR-607	CLIP-seq
MIRT1474254	hsa-miR-622	CLIP-seq
MIRT1474255	hsa-miR-625	CLIP-seq
MIRT1474256	hsa-miR-654-5p	CLIP-seq
MIRT1474257	hsa-miR-655	CLIP-seq
MIRT1474258	hsa-miR-7	CLIP-seq
MIRT1474259	hsa-miR-873	CLIP-seq
MIRT1474260	hsa-miR-9	CLIP-seq
MIRT1474261	hsa-miR-98	CLIP-seq
MIRT1474172	hsa-miR-148a	CLIP-seq
MIRT1474173	hsa-miR-148b	CLIP-seq
MIRT1474174	hsa-miR-152	CLIP-seq
MIRT1474204	hsa-miR-3119	CLIP-seq
MIRT1474206	hsa-miR-323-3p	CLIP-seq
MIRT1474212	hsa-miR-374c	CLIP-seq
MIRT2142725	hsa-miR-4662a-5p	CLIP-seq
MIRT2142726	hsa-miR-4676-5p	CLIP-seq
MIRT2142727	hsa-miR-548c-3p	CLIP-seq
MIRT2142728	hsa-miR-575	CLIP-seq
MIRT1474257	hsa-miR-655	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
E2F1	Activation	12838312;15361834
E2F1	Unknown	23023523
TP53	Repression	18220474;19501055

Show/Hide all (66)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21777816
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	TAS	33939809
GO:0000785	Component	Chromatin	IDA	17673620
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISS
GO:0000791	Component	Euchromatin	IDA	21777816
GO:0000792	Component	Heterochromatin	IDA	17967883, 21489993, 21777816
GO:0000792	Component	Heterochromatin	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	10646863
GO:0003676	Function	Nucleic acid binding	EXP	18772889
GO:0003677	Function	DNA binding	IEA
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	17967883, 21745816, 22945642
GO:0005515	Function	Protein binding	IPI	15361834, 17673620, 17934516, 19798101, 21745816, 22945642, 32051553
GO:0005634	Component	Nucleus	IDA	10646863
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005657	Component	Replication fork	IDA	17673620
GO:0005657	Component	Replication fork	IEA
GO:0005819	Component	Spindle	IC	37728657
GO:0006281	Process	DNA repair	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	22945642
GO:0006950	Process	Response to stress	IEA
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	TAS	33939809
GO:0008270	Function	Zinc ion binding	IDA	21777816
GO:0008270	Function	Zinc ion binding	IEA
GO:0008327	Function	Methyl-CpG binding	IDA	15361834, 21029866
GO:0016363	Component	Nuclear matrix	IEA
GO:0016363	Component	Nuclear matrix	ISS
GO:0016567	Process	Protein ubiquitination	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031507	Process	Heterochromatin formation	IDA	17967883
GO:0035825	Process	Homologous recombination	TAS	33939809
GO:0040029	Process	Epigenetic regulation of gene expression	TAS	33939809
GO:0042393	Function	Histone binding	IDA	21777816
GO:0042393	Function	Histone binding	IEA
GO:0042393	Function	Histone binding	ISS
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IBA
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IEA
GO:0044027	Process	Negative regulation of gene expression via chromosomal CpG island methylation	IMP	17673620
GO:0044729	Function	Hemi-methylated DNA-binding	IDA	17673620
GO:0044729	Function	Hemi-methylated DNA-binding	IEA
GO:0044729	Function	Hemi-methylated DNA-binding	TAS	33939809
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10646863
GO:0046872	Function	Metal ion binding	IEA
GO:0050678	Process	Regulation of epithelial cell proliferation	IMP	15361834
GO:0051247	Process	Positive regulation of protein metabolic process	IDA	10646863
GO:0051865	Process	Protein autoubiquitination	IDA	21745816
GO:0051865	Process	Protein autoubiquitination	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IDA	37728657
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	ISS
GO:0062072	Function	Histone H3K9me2/3 reader activity	IDA	17967883, 21029866, 21489993
GO:0062072	Function	Histone H3K9me2/3 reader activity	IEA
GO:0062072	Function	Histone H3K9me2/3 reader activity	TAS	33939809
GO:0090307	Process	Mitotic spindle assembly	IDA	19001501, 37728657
GO:0090307	Process	Mitotic spindle assembly	IDA	37728657
GO:0140612	Function	DNA damage sensor activity	TAS	33939809
GO:0141055	Function	Histone H3 ubiquitin ligase activity	IEA
GO:0141055	Function	Histone H3 ubiquitin ligase activity	ISS

MIM	HGNC	e!Ensembl
607990	12556	ENSG00000276043

Q96T88

Protein name

E3 ubiquitin-protein ligase UHRF1 (EC 2.3.2.27) (Inverted CCAAT box-binding protein of 90 kDa) (Nuclear protein 95) (Nuclear zinc finger protein Np95) (HuNp95) (hNp95) (RING finger protein 106) (RING-type E3 ubiquitin transferase UHRF1) (Transcription fac

Protein function

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase

PDB

2FAZ , 2L3R , 2LGG , 2LGK , 2LGL , 2PB7 , 3ASK , 3ASL , 3BI7 , 3CLZ , 3DB3 , 3DB4 , 3DWH , 3FL2 , 3SHB , 3SOU , 3SOW , 3SOX , 3T6R , 3ZVY , 3ZVZ , 4GY5 , 4QQD , 5C6D , 5IAY , 5XPI , 5YY9 , 5YYA , 6B9M , 6IIW , 6VCS , 6VED , 6VYJ , 6W92 , 7FB7 , 8JIG , 8WMS , 8XV4 , 8XV6 , 8XV7 , 8XV8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 76	Ubiquitin family	Domain
PF12148	TTD	132 → 284	Tandem tudor domain within UHRF1	Domain
PF00628	PHD	317 → 366	PHD-finger	Domain
PF02182	SAD_SRA	417 → 586	SAD/SRA domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. {ECO:0000269|PubMed:10646863, ECO:0000269|PubMed:12838312, ECO:0000269|PubMed:15361834}.

Sequence

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR

Sequence length

793

Interactions

View interactions

UHRF1 (ubiquitin like with PHD and ring finger domains 1)