Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	29128
Gene name Gene Name - the full gene name approved by the HGNC.	Ubiquitin like with PHD and ring finger domains 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	UHRF1
Synonyms (NCBI Gene) Gene synonyms aliases	ICBP90, Np95, RNF106, TDRD22, hNP95, hUHRF1, huNp95
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2

Show/Hide all(138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001580	hsa-let-7b-5p	pSILAC	18668040
MIRT001324	hsa-miR-1-3p	pSILAC	18668040
MIRT002574	hsa-miR-124-3p	Microarray	15685193
MIRT002574	hsa-miR-124-3p	Microarray;Other	15685193
MIRT001324	hsa-miR-1-3p	Proteomics;Other	18668040
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025268	hsa-miR-34a-5p	Proteomics	21566225
MIRT025644	hsa-miR-7-5p	Microarray	19073608
MIRT001580	hsa-let-7b-5p	Proteomics;Other	18668040
MIRT052615	hsa-let-7a-5p	CLASH	23622248
MIRT047656	hsa-miR-10a-5p	CLASH	23622248
MIRT047494	hsa-miR-10b-5p	CLASH	23622248
MIRT025268	hsa-miR-34a-5p	CLASH	23622248
MIRT046925	hsa-miR-221-3p	CLASH	23622248
MIRT045790	hsa-miR-191-5p	CLASH	23622248
MIRT039881	hsa-miR-615-3p	CLASH	23622248
MIRT039881	hsa-miR-615-3p	CLASH	23622248
MIRT021236	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Western blot	23982143
MIRT021236	hsa-miR-146a-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Western blot	23982143
MIRT053567	hsa-miR-146b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Western blot	23982143
MIRT053567	hsa-miR-146b-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, Western blot	23982143
MIRT052615	hsa-let-7a-5p	Luciferase reporter assay, qRT-PCR, Western blot	26049093
MIRT002574	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26310391
MIRT002574	hsa-miR-124-3p	Luciferase reporter assay, Western blot	26310391
MIRT001580	hsa-let-7b-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31873045
MIRT756026	hsa-miR-520d-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ChIP-seq	35664070
MIRT1474167	hsa-miR-101	CLIP-seq
MIRT1474168	hsa-miR-1263	CLIP-seq
MIRT1474169	hsa-miR-1283	CLIP-seq
MIRT1474170	hsa-miR-1305	CLIP-seq
MIRT1474171	hsa-miR-144	CLIP-seq
MIRT1474172	hsa-miR-148a	CLIP-seq
MIRT1474173	hsa-miR-148b	CLIP-seq
MIRT1474174	hsa-miR-152	CLIP-seq
MIRT1474175	hsa-miR-3133	CLIP-seq
MIRT1474176	hsa-miR-4301	CLIP-seq
MIRT1474177	hsa-miR-4307	CLIP-seq
MIRT1474178	hsa-miR-4511	CLIP-seq
MIRT1474179	hsa-miR-548b-3p	CLIP-seq
MIRT1474180	hsa-miR-578	CLIP-seq
MIRT1474181	hsa-miR-606	CLIP-seq
MIRT1474182	hsa-miR-607	CLIP-seq
MIRT1474183	hsa-let-7a	CLIP-seq
MIRT1474184	hsa-let-7b	CLIP-seq
MIRT1474185	hsa-let-7c	CLIP-seq
MIRT1474186	hsa-let-7d	CLIP-seq
MIRT1474187	hsa-let-7e	CLIP-seq
MIRT1474188	hsa-let-7f	CLIP-seq
MIRT1474189	hsa-let-7g	CLIP-seq
MIRT1474190	hsa-let-7i	CLIP-seq
MIRT1474191	hsa-miR-1243	CLIP-seq
MIRT1474192	hsa-miR-1275	CLIP-seq
MIRT1474193	hsa-miR-1278	CLIP-seq
MIRT1474194	hsa-miR-1292	CLIP-seq
MIRT1474195	hsa-miR-1304	CLIP-seq
MIRT1474170	hsa-miR-1305	CLIP-seq
MIRT1474196	hsa-miR-135a	CLIP-seq
MIRT1474197	hsa-miR-135b	CLIP-seq
MIRT1474198	hsa-miR-1827	CLIP-seq
MIRT1474199	hsa-miR-188-5p	CLIP-seq
MIRT1474200	hsa-miR-200b	CLIP-seq
MIRT1474201	hsa-miR-200c	CLIP-seq
MIRT1474202	hsa-miR-202	CLIP-seq
MIRT1474203	hsa-miR-2909	CLIP-seq
MIRT1474204	hsa-miR-3119	CLIP-seq
MIRT1474175	hsa-miR-3133	CLIP-seq
MIRT1474205	hsa-miR-3162-5p	CLIP-seq
MIRT1474206	hsa-miR-323-3p	CLIP-seq
MIRT1474207	hsa-miR-339-5p	CLIP-seq
MIRT1474208	hsa-miR-3545-3p	CLIP-seq
MIRT1474209	hsa-miR-3646	CLIP-seq
MIRT1474210	hsa-miR-3654	CLIP-seq
MIRT1474211	hsa-miR-371-5p	CLIP-seq
MIRT1474212	hsa-miR-374c	CLIP-seq
MIRT1474213	hsa-miR-378	CLIP-seq
MIRT1474214	hsa-miR-378b	CLIP-seq
MIRT1474215	hsa-miR-378c	CLIP-seq
MIRT1474216	hsa-miR-378d	CLIP-seq
MIRT1474217	hsa-miR-378e	CLIP-seq
MIRT1474218	hsa-miR-378f	CLIP-seq
MIRT1474219	hsa-miR-378h	CLIP-seq
MIRT1474220	hsa-miR-378i	CLIP-seq
MIRT1474221	hsa-miR-3929	CLIP-seq
MIRT1474222	hsa-miR-3973	CLIP-seq
MIRT1474223	hsa-miR-422a	CLIP-seq
MIRT1474224	hsa-miR-4251	CLIP-seq
MIRT1474225	hsa-miR-4261	CLIP-seq
MIRT1474226	hsa-miR-4274	CLIP-seq
MIRT1474227	hsa-miR-4282	CLIP-seq
MIRT1474228	hsa-miR-429	CLIP-seq
MIRT1474229	hsa-miR-4299	CLIP-seq
MIRT1474177	hsa-miR-4307	CLIP-seq
MIRT1474230	hsa-miR-4419b	CLIP-seq
MIRT1474231	hsa-miR-4447	CLIP-seq
MIRT1474232	hsa-miR-4456	CLIP-seq
MIRT1474233	hsa-miR-4458	CLIP-seq
MIRT1474234	hsa-miR-4461	CLIP-seq
MIRT1474235	hsa-miR-4464	CLIP-seq
MIRT1474236	hsa-miR-4472	CLIP-seq
MIRT1474237	hsa-miR-4478	CLIP-seq
MIRT1474238	hsa-miR-4496	CLIP-seq
MIRT1474239	hsa-miR-4500	CLIP-seq
MIRT1474240	hsa-miR-4501	CLIP-seq
MIRT1474178	hsa-miR-4511	CLIP-seq
MIRT1474241	hsa-miR-4525	CLIP-seq
MIRT1474242	hsa-miR-4638-3p	CLIP-seq
MIRT1474243	hsa-miR-4665-5p	CLIP-seq
MIRT1474244	hsa-miR-4668-3p	CLIP-seq
MIRT1474245	hsa-miR-4723-5p	CLIP-seq
MIRT1474246	hsa-miR-4731-3p	CLIP-seq
MIRT1474247	hsa-miR-4748	CLIP-seq
MIRT1474248	hsa-miR-4801	CLIP-seq
MIRT1474249	hsa-miR-541	CLIP-seq
MIRT1474250	hsa-miR-548k	CLIP-seq
MIRT1474251	hsa-miR-548q	CLIP-seq
MIRT1474252	hsa-miR-553	CLIP-seq
MIRT1474253	hsa-miR-580	CLIP-seq
MIRT1474182	hsa-miR-607	CLIP-seq
MIRT1474254	hsa-miR-622	CLIP-seq
MIRT1474255	hsa-miR-625	CLIP-seq
MIRT1474256	hsa-miR-654-5p	CLIP-seq
MIRT1474257	hsa-miR-655	CLIP-seq
MIRT1474258	hsa-miR-7	CLIP-seq
MIRT1474259	hsa-miR-873	CLIP-seq
MIRT1474260	hsa-miR-9	CLIP-seq
MIRT1474261	hsa-miR-98	CLIP-seq
MIRT1474172	hsa-miR-148a	CLIP-seq
MIRT1474173	hsa-miR-148b	CLIP-seq
MIRT1474174	hsa-miR-152	CLIP-seq
MIRT1474204	hsa-miR-3119	CLIP-seq
MIRT1474206	hsa-miR-323-3p	CLIP-seq
MIRT1474212	hsa-miR-374c	CLIP-seq
MIRT2142725	hsa-miR-4662a-5p	CLIP-seq
MIRT2142726	hsa-miR-4676-5p	CLIP-seq
MIRT2142727	hsa-miR-548c-3p	CLIP-seq
MIRT2142728	hsa-miR-575	CLIP-seq
MIRT1474257	hsa-miR-655	CLIP-seq

Transcription factors

Show/Hide all(3)

Transcription factor	Regulation	Reference
E2F1	Activation	12838312;15361834
E2F1	Unknown	23023523
TP53	Repression	18220474;19501055

Show/Hide all(35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	21777816
GO:0000785	Component	Chromatin	IDA	17673620
GO:0000785	Component	Chromatin	ISS
GO:0000791	Component	Euchromatin	IDA	21777816
GO:0000792	Component	Heterochromatin	IDA	17967883, 21489993, 21777816
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IDA	10646863
GO:0004842	Function	Ubiquitin-protein transferase activity	IDA	17967883, 21745816, 22945642
GO:0005515	Function	Protein binding	IPI	15361834, 17673620, 17934516, 19798101, 21745816, 22945642
GO:0005634	Component	Nucleus	IDA	10646863
GO:0005654	Component	Nucleoplasm	IDA
GO:0005657	Component	Replication fork	IDA	17673620
GO:0006281	Process	DNA repair	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	22945642
GO:0007049	Process	Cell cycle	IEA
GO:0008270	Function	Zinc ion binding	IDA	21777816
GO:0008327	Function	Methyl-CpG binding	IDA	15361834, 21029866
GO:0010216	Process	Maintenance of DNA methylation	IBA	21873635
GO:0010216	Process	Maintenance of DNA methylation	IMP	17673620
GO:0010390	Process	Histone monoubiquitination	IBA	21873635
GO:0010390	Process	Histone monoubiquitination	ISS
GO:0016363	Component	Nuclear matrix	ISS
GO:0016567	Process	Protein ubiquitination	IBA	21873635
GO:0016574	Process	Histone ubiquitination	IDA	17967883
GO:0031493	Function	Nucleosomal histone binding	ISS
GO:0032270	Process	Positive regulation of cellular protein metabolic process	IDA	10646863
GO:0035064	Function	Methylated histone binding	IDA	17967883, 21029866, 21489993
GO:0042393	Function	Histone binding	IDA	21777816
GO:0042802	Function	Identical protein binding	ISS
GO:0044729	Function	Hemi-methylated DNA-binding	IDA	17673620
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IC	10646863
GO:0050678	Process	Regulation of epithelial cell proliferation	IMP	15361834
GO:0051865	Process	Protein autoubiquitination	IDA	17967883, 21745816
GO:0061630	Function	Ubiquitin protein ligase activity	IBA	21873635
GO:0061630	Function	Ubiquitin protein ligase activity	ISS
GO:2000373	Process	Positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity	IC	10646863

MIM	HGNC	e!Ensembl
607990	12556	ENSG00000276043

Protein

UniProt ID

Q96T88

Protein name

E3 ubiquitin-protein ligase UHRF1 (EC 2.3.2.27) (Inverted CCAAT box-binding protein of 90 kDa) (Nuclear protein 95) (Nuclear zinc finger protein Np95) (HuNp95) (hNp95) (RING finger protein 106) (RING-type E3 ubiquitin transferase UHRF1) (Transcription fac

Protein function

Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase

PDB

2FAZ , 2L3R , 2LGG , 2LGK , 2LGL , 2PB7 , 3ASK , 3ASL , 3BI7 , 3CLZ , 3DB3 , 3DB4 , 3DWH , 3FL2 , 3SHB , 3SOU , 3SOW , 3SOX , 3T6R , 3ZVY , 3ZVZ , 4GY5 , 4QQD , 5C6D , 5IAY , 5XPI , 5YY9 , 5YYA , 6B9M , 6IIW , 6VCS , 6VED , 6VYJ , 6W92 , 7FB7 , 8JIG , 8WMS , 8XV4 , 8XV6 , 8XV7 , 8XV8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00240	ubiquitin	3 → 76	Ubiquitin family	Domain
PF12148	TTD	132 → 284	Tandem tudor domain within UHRF1	Domain
PF00628	PHD	317 → 366	PHD-finger	Domain
PF02182	SAD_SRA	417 → 586	SAD/SRA domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. {ECO:0000269|PubMed:10646863, ECO:0000269|PubMed:12838312, ECO:0000269|PubMed:15361834}.

Sequence

MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQSLVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRNDASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR

Sequence length

793

Interactions

View interactions

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Adenocarcinoma	Adenoid Cystic Carcinoma	rs121913530, rs886039394, rs121913474	23685749

Show/Hide Unknown Diseases (6)

Disease term	Disease name	References	Source
Unknown
Myocardial infarction	Myocardial Infarction	21211798	ClinVar
Schizophrenia	Schizophrenia		GWAS
Diabetes	Diabetes		GWAS
Metabolic Syndrome	Metabolic Syndrome		GWAS
Coronary artery disease	Coronary artery disease		GWAS
Insomnia	Insomnia		GWAS

Show/Hide Text Mining Associations (69)

Disease Name	Relationship Type	References
Associations from Text Mining
Acquired Immunodeficiency Syndrome	Associate	34465029
Adenocarcinoma	Associate	25889361, 32495469
Adenocarcinoma of Lung	Associate	31503425, 32495469
Alzheimer Disease	Inhibit	36646969
Arthritis Rheumatoid	Associate	26752645
Ataxia Telangiectasia	Associate	40579780
Birk Barel Mental Retardation Dysmorphism Syndrome	Associate	35296332
Breast Neoplasms	Associate	23107467, 36591654, 37958803
Burkitt Lymphoma	Associate	32424339
Carcinogenesis	Associate	23677994, 24637615, 25272010, 25940709, 26497117, 26768845, 32495469, 35403252, 38556072
Carcinoma Hepatocellular	Associate	26464697, 28584306, 31442209, 37380646
Carcinoma Non Small Cell Lung	Associate	20517312, 21351083, 27437769, 29516630, 32495469, 33658396, 36778111
Carcinoma Pancreatic Ductal	Associate	26497117, 35403252
Carcinoma Renal Cell	Associate	27487138, 31422942, 37671388
Carcinoma Squamous Cell	Associate	28849055
Carcinoma Squamous Cell	Stimulate	32495469
Carcinoma Transitional Cell	Associate	28128913
Cell Transformation Neoplastic	Associate	33800494
Colonic Neoplasms	Associate	26768845
Colorectal Neoplasms	Associate	24324066, 25940709, 26768845, 28241740, 31064417, 35211429, 35951156, 37671388
Colorectal Neoplasms	Stimulate	35951156
Creutzfeldt Jakob Disease Sporadic	Associate	32918118
Death	Associate	31503425
Ectodermal Dysplasia	Stimulate	37887281
Episodic Kinesigenic Dyskinesia 2	Associate	29849118
Esophageal Squamous Cell Carcinoma	Associate	27507047
Fanconi Anemia	Associate	25801034
Hepatoblastoma	Associate	29507645, 38285887
Hereditary Breast and Ovarian Cancer Syndrome	Associate	23107467
Hypoxia	Inhibit	28584306
IgA Vasculitis	Associate	26752645
Immunodeficiency syndrome variable	Associate	33082427
Infertility	Associate	31802345
Kidney Neoplasms	Stimulate	19491893
Leukemia	Associate	25765655, 36302855
Leukemia Myeloid	Associate	36302855
Leukemia Myeloid Acute	Associate	25996682, 30480765, 36302855
Lung Neoplasms	Associate	20517312, 21351083, 28849055
Lupus Erythematosus Systemic	Associate	36075396
Lymphatic Metastasis	Associate	23107467
Lymphoma	Associate	28901428
Melanoma	Stimulate	29620240
Mesothelioma Malignant	Associate	33800494
Muscle Neoplasms	Stimulate	19491893
Neoplasm Metastasis	Associate	20517312, 23297342, 26464697
Neoplasm Metastasis	Stimulate	37671388
Neoplasms	Associate	12838312, 16195352, 21351083, 22945642, 23297342, 24637615, 25272010, 25323766, 25349215, 25743796, 25996682, 26070868, 26464697, 27072587, 27114453 View all (18 more)
Neoplasms	Inhibit	25940709, 33795533
Neoplasms	Stimulate	27507047
Neurologic Manifestations	Associate	35429693
Non Muscle Invasive Bladder Neoplasms	Associate	28128913
Obesity	Associate	31428652
Oligospermia	Associate	31802345
Ovarian Neoplasms	Associate	25743796, 26070868
Pancreatic Neoplasms	Associate	26497117
Parkinson Disease	Associate	36593912
Pre Eclampsia	Associate	35296332
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	29849118
Prostatic Neoplasms	Associate	26884069, 36681316
Retinoblastoma	Associate	29415984
Squamous Cell Carcinoma of Head and Neck	Associate	34398824
Stomach Neoplasms	Associate	26831603
Tertiary Lymphoid Structures	Associate	20517312
Thymoma	Associate	31442209
Thyroid Neoplasms	Associate	19809427
Urinary Bladder Neoplasms	Associate	19491893, 25323766, 27072587, 28128913
Urinary Bladder Neoplasms	Stimulate	25272010
Urogenital Neoplasms	Associate	25349215
Uterine Cervical Neoplasms	Associate	19270723, 23688286, 29157076, 33795533, 38556072

UHRF1 (ubiquitin like with PHD and ring finger domains 1)