Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
29128
Gene name Gene Name - the full gene name approved by the HGNC.
Ubiquitin like with PHD and ring finger domains 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
UHRF1
Synonyms (NCBI Gene) Gene synonyms aliases
ICBP90, Np95, RNF106, TDRD22, hNP95, hUHRF1, huNp95
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT001580 hsa-let-7b-5p pSILAC 18668040
MIRT001324 hsa-miR-1-3p pSILAC 18668040
MIRT002574 hsa-miR-124-3p Microarray 15685193
MIRT002574 hsa-miR-124-3p Microarray;Other 15685193
MIRT001324 hsa-miR-1-3p Proteomics;Other 18668040
Transcription factors
Transcription factor Regulation Reference
E2F1 Activation 12838312;15361834
E2F1 Unknown 23023523
TP53 Repression 18220474;19501055
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IDA 21777816
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000724 Process Double-strand break repair via homologous recombination TAS 33939809
GO:0000785 Component Chromatin IDA 17673620
GO:0000785 Component Chromatin IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
607990 12556 ENSG00000276043
Protein
UniProt ID Q96T88
Protein name E3 ubiquitin-protein ligase UHRF1 (EC 2.3.2.27) (Inverted CCAAT box-binding protein of 90 kDa) (Nuclear protein 95) (Nuclear zinc finger protein Np95) (HuNp95) (hNp95) (RING finger protein 106) (RING-type E3 ubiquitin transferase UHRF1) (Transcription fac
Protein function Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase
PDB 2FAZ , 2L3R , 2LGG , 2LGK , 2LGL , 2PB7 , 3ASK , 3ASL , 3BI7 , 3CLZ , 3DB3 , 3DB4 , 3DWH , 3FL2 , 3SHB , 3SOU , 3SOW , 3SOX , 3T6R , 3ZVY , 3ZVZ , 4GY5 , 4QQD , 5C6D , 5IAY , 5XPI , 5YY9 , 5YYA , 6B9M , 6IIW , 6VCS , 6VED , 6VYJ , 6W92 , 7FB7 , 8JIG , 8WMS , 8XV4 , 8XV6 , 8XV7 , 8XV8
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00240 ubiquitin 3 76 Ubiquitin family Domain
PF12148 TTD 132 284 Tandem tudor domain within UHRF1 Domain
PF00628 PHD 317 366 PHD-finger Domain
PF02182 SAD_SRA 417 586 SAD/SRA domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in thymus, bone marrow, testis, lung and heart. Overexpressed in breast cancer. {ECO:0000269|PubMed:10646863, ECO:0000269|PubMed:12838312, ECO:0000269|PubMed:15361834}.
Sequence
MWIQVRTMDGRQTHTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQMEDGHTLFD
YEVRLNDTIQLLVRQS
LVLPHSTKERDSELSDTDSGCCLGQSESDKSSTHGEAAAETDSR
PADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQVVRVTRKAPSRDEPCSSTSRPALEE
DVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYD
AEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPG
EGSPMVDNPMRRKSGP
SCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYC
PECRND
ASEVVLAGERLRESKKKAKMASATSSSQRDWGKGMACVGRTKECTIVPSNHYGP
IPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGNFFTYTG
SGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDQEGAEAKDWRSGKPVRVVRNVK
GGKNSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDE
PGPWTKEGKDRIKK
LGLTMQYPEGYLEALANREREKENSKREEEEQQEGGFASPRTGKGKWKRKSAGGGPSRAG
SPRRTSKKTKVEPYSLTAQQSSLIREDKSNAKLWNEVLASLKDRPASGSPFQLFLSKVEE
TFQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSCPACRYDLGRSYAMQVNQPLQT
VLNQLFPGYGNGR
Sequence length 793
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Coronary artery disease Coronary artery disease N/A N/A GWAS
Diabetes Triglyceride levels in non-type 2 diabetes, Type 2 diabetes, Type 2 diabetes mellitus or coronary artery disease (pleiotropy), Type 2 diabetes mellitus adjusted for BMI or coronary artery disease (pleiotropy) N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Acquired Immunodeficiency Syndrome Associate 34465029
Adenocarcinoma Associate 25889361, 32495469
Adenocarcinoma of Lung Associate 31503425, 32495469
Alzheimer Disease Inhibit 36646969
Arthritis Rheumatoid Associate 26752645
Ataxia Telangiectasia Associate 40579780
Birk Barel Mental Retardation Dysmorphism Syndrome Associate 35296332
Breast Neoplasms Associate 23107467, 36591654, 37958803
Burkitt Lymphoma Associate 32424339
Carcinogenesis Associate 23677994, 24637615, 25272010, 25940709, 26497117, 26768845, 32495469, 35403252, 38556072