Gene Gene information from NCBI Gene database.
Entrez ID 29121
Gene name C-type lectin domain family 2 member D
Gene symbol CLEC2D
Synonyms (NCBI Gene)
CLAXLLT1OCIL
Chromosome 12
Chromosome location 12p13.31
Summary This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several
miRNA miRNA information provided by mirtarbase database.
963
miRTarBase ID miRNA Experiments Reference
MIRT500165 hsa-miR-200b-3p HITS-CLIP 21572407
MIRT500164 hsa-miR-200c-3p HITS-CLIP 21572407
MIRT500163 hsa-miR-429 HITS-CLIP 21572407
MIRT500162 hsa-miR-205-3p HITS-CLIP 21572407
MIRT500161 hsa-miR-6767-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 10541800
GO:0005515 Function Protein binding IPI 21572041, 32296183, 32814053
GO:0005783 Component Endoplasmic reticulum IDA 20843815
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605659 14351 ENSG00000069493
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UHP7
Protein name C-type lectin domain family 2 member D (Lectin-like NK cell receptor) (Lectin-like transcript 1) (LLT-1) (Osteoclast inhibitory lectin)
Protein function Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis (PubMed:16339513, PubMed:20843815). Inhibits osteoclast formation (PubMed:14753741, PubMed:15123656). Inhibits bone resorption (PubMed:14753741). Modulates
PDB 4QKG , 4QKH , 4QKI , 4QKJ , 4WCO , 5MGT
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 92 186 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in peripheral blood leukocytes, osteoblasts, lymph node, thymus and spleen. Isoform 1, isoform 2 and isoform 4 are expressed in T- and B-lymphocytes, and at lower levels in NK cells. They are also expressed in B-cell lines and
Sequence
MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIR
ANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELN
FLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTER
KWICSK
SDIHV
Sequence length 191
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell