Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID	29108
Gene name	PYD and CARD domain containing
Gene symbol	PYCARD
Synonyms (NCBI Gene)	ASCCARD5TMSTMS-1TMS1
Chromosome	16
Chromosome location	16p11.2
Summary	This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain (PYD) and a C-terminal caspase-recruitment domain (CARD). The PYD and CARD domains are members of the six-helix bundle d

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022399	hsa-miR-124-3p	Microarray	18668037
MIRT650297	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT650296	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT650295	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650294	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650293	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650292	hsa-miR-4469	HITS-CLIP	23824327
MIRT650290	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650291	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650289	hsa-miR-1251-3p	HITS-CLIP	23824327
MIRT650288	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT650287	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650286	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650285	hsa-miR-548aw	HITS-CLIP	23824327
MIRT650284	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT650283	hsa-miR-527	HITS-CLIP	23824327
MIRT650282	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT519238	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT519237	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT519236	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT519235	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT519234	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT519233	hsa-miR-3975	PAR-CLIP	23446348
MIRT519232	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT519231	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT519230	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT519229	hsa-miR-3188	PAR-CLIP	23446348
MIRT519228	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT519227	hsa-miR-3135b	PAR-CLIP	23446348
MIRT519226	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT519225	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT519224	hsa-miR-765	PAR-CLIP	23446348
MIRT519223	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT519222	hsa-miR-3652	PAR-CLIP	23446348
MIRT519221	hsa-miR-4430	PAR-CLIP	23446348
MIRT519220	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT519219	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519217	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT519218	hsa-miR-1273e	PAR-CLIP	23446348
MIRT519216	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT650297	hsa-miR-4753-5p	HITS-CLIP	23824327
MIRT650296	hsa-miR-3922-5p	HITS-CLIP	23824327
MIRT650295	hsa-miR-6892-3p	HITS-CLIP	23824327
MIRT650294	hsa-miR-2276-5p	HITS-CLIP	23824327
MIRT650293	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT650292	hsa-miR-4469	HITS-CLIP	23824327
MIRT650290	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT650291	hsa-miR-676-5p	HITS-CLIP	23824327
MIRT650289	hsa-miR-1251-3p	HITS-CLIP	23824327
MIRT650288	hsa-miR-561-5p	HITS-CLIP	23824327
MIRT650287	hsa-miR-642a-5p	HITS-CLIP	23824327
MIRT650286	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT650285	hsa-miR-548aw	HITS-CLIP	23824327
MIRT650284	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT650283	hsa-miR-527	HITS-CLIP	23824327
MIRT650282	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT519238	hsa-miR-1915-3p	PAR-CLIP	23446348
MIRT519237	hsa-miR-6764-5p	PAR-CLIP	23446348
MIRT519236	hsa-miR-17-3p	PAR-CLIP	23446348
MIRT519235	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT519234	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT519233	hsa-miR-3975	PAR-CLIP	23446348
MIRT519232	hsa-miR-2467-5p	PAR-CLIP	23446348
MIRT519231	hsa-miR-485-5p	PAR-CLIP	23446348
MIRT519230	hsa-miR-6884-5p	PAR-CLIP	23446348
MIRT519229	hsa-miR-3188	PAR-CLIP	23446348
MIRT519228	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT519227	hsa-miR-3135b	PAR-CLIP	23446348
MIRT519226	hsa-miR-766-5p	PAR-CLIP	23446348
MIRT519225	hsa-miR-7154-3p	PAR-CLIP	23446348
MIRT519224	hsa-miR-765	PAR-CLIP	23446348
MIRT519223	hsa-miR-6894-5p	PAR-CLIP	23446348
MIRT519222	hsa-miR-3652	PAR-CLIP	23446348
MIRT519221	hsa-miR-4430	PAR-CLIP	23446348
MIRT519220	hsa-miR-193b-5p	PAR-CLIP	23446348
MIRT519219	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT519217	hsa-miR-6765-5p	PAR-CLIP	23446348
MIRT519218	hsa-miR-1273e	PAR-CLIP	23446348
MIRT519216	hsa-miR-1304-5p	PAR-CLIP	23446348
MIRT2689188	hsa-miR-3163	CLIP-seq
MIRT2689189	hsa-miR-383	CLIP-seq
MIRT2689190	hsa-miR-568	CLIP-seq

161

Show/Hide all (161)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	23229815
GO:0000139	Component	Golgi membrane	IEA
GO:0001773	Process	Myeloid dendritic cell activation	IEA
GO:0001773	Process	Myeloid dendritic cell activation	IMP	22732093
GO:0002020	Function	Protease binding	IEA
GO:0002020	Function	Protease binding	IPI	24407287
GO:0002218	Process	Activation of innate immune response	IBA
GO:0002218	Process	Activation of innate immune response	IEA
GO:0002221	Process	Pattern recognition receptor signaling pathway	NAS	21918512, 22258606, 29196474, 29247998
GO:0002230	Process	Positive regulation of defense response to virus by host	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	ISS
GO:0002376	Process	Immune system process	IEA
GO:0002588	Process	Positive regulation of antigen processing and presentation of peptide antigen via MHC class II	IEA
GO:0002588	Process	Positive regulation of antigen processing and presentation of peptide antigen via MHC class II	ISS
GO:0002821	Process	Positive regulation of adaptive immune response	IMP	22732093
GO:0005138	Function	Interleukin-6 receptor binding	IPI	24407287
GO:0005515	Function	Protein binding	IPI	11498534, 11786556, 12019269, 12656673, 14730312, 15020601, 15030775, 17178784, 17418785, 17964261, 19158675, 19158676, 22286270, 24237704, 24407287, 24531343, 24630722, 25006247, 25277106, 25402006, 25416956, 25605870, 28229991, 28636595, 31421660, 34341353, 34589402, 38593810
GO:0005523	Function	Tropomyosin binding	IPI	24407287
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	NAS	28263976
GO:0005737	Component	Cytoplasm	IDA	14730312, 15030775, 19158679
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	12019269, 19158676, 24803432, 28263976
GO:0005739	Component	Mitochondrion	IDA	14730312
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005874	Component	Microtubule	NAS	27911804
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10567338
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	NAS	12019269
GO:0007231	Process	Osmosensory signaling pathway	NAS	22981536
GO:0008385	Component	IkappaB kinase complex	IDA	12486103
GO:0008385	Component	IkappaB kinase complex	IEA
GO:0008385	Component	IkappaB kinase complex	TAS	12656673
GO:0009617	Process	Response to bacterium	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IEA
GO:0010803	Process	Regulation of tumor necrosis factor-mediated signaling pathway	IMP	14730312
GO:0016020	Component	Membrane	IEA
GO:0017024	Function	Myosin I binding	IPI	24407287
GO:0019899	Function	Enzyme binding	IPI	24407287
GO:0030838	Process	Positive regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	ISS
GO:0031647	Process	Regulation of protein stability	IEA
GO:0031647	Process	Regulation of protein stability	ISS
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IMP	16585594
GO:0032090	Function	Pyrin domain binding	IPI	15030775
GO:0032688	Process	Negative regulation of interferon-beta production	IMP	19158675
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	IMP	21487011
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0032729	Process	Positive regulation of type II interferon production	ISS
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IDA	7642516, 15030775, 16037825, 24630722
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IMP	22267217
GO:0032731	Process	Positive regulation of interleukin-1 beta production	ISO
GO:0032731	Process	Positive regulation of interleukin-1 beta production	NAS	21918512
GO:0032733	Process	Positive regulation of interleukin-10 production	IMP	16982856
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	IMP	16982856
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IMP	16982856
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IMP	16982856, 21487011
GO:0032991	Component	Protein-containing complex	IDA	22267217
GO:0032991	Component	Protein-containing complex	IEA
GO:0033209	Process	Tumor necrosis factor-mediated signaling pathway	IDA	12656673
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035578	Component	Azurophil granule lumen	TAS
GO:0038187	Function	Pattern recognition receptor activity	IBA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	ISS
GO:0042742	Process	Defense response to bacterium	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	14730312
GO:0042802	Function	Identical protein binding	IDA	34341353
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	24630722, 25006247, 25416956
GO:0042803	Function	Protein homodimerization activity	IDA	15030775
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12646168
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	12656673
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	12486103
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044351	Process	Macropinocytosis	IEA
GO:0044351	Process	Macropinocytosis	ISS
GO:0044546	Process	NLRP3 inflammasome complex assembly	IDA	27432880
GO:0045087	Process	Innate immune response	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IMP	21487011
GO:0046456	Process	Icosanoid biosynthetic process	NAS	22902502
GO:0046983	Function	Protein dimerization activity	IDA	24531343
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050727	Process	Regulation of inflammatory response	IDA	21575908
GO:0050727	Process	Regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	12191486
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISO
GO:0050729	Process	Positive regulation of inflammatory response	NAS	21918512, 24630722, 29255148
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IMP	16982856, 21487011
GO:0050830	Process	Defense response to Gram-positive bacterium	IEA
GO:0050870	Process	Positive regulation of T cell activation	IEA
GO:0050870	Process	Positive regulation of T cell activation	IMP	22732093
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IDA	19494289
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	12646168
GO:0051260	Process	Protein homooligomerization	IDA	24531343
GO:0051260	Process	Protein homooligomerization	IEA
GO:0051607	Process	Defense response to virus	IDA	21575908
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	NAS	28314590
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0061702	Component	Canonical inflammasome complex	IEA
GO:0061702	Component	Canonical inflammasome complex	IPI	16037825
GO:0061702	Component	Canonical inflammasome complex	NAS	25879286
GO:0070269	Process	Pyroptotic inflammatory response	NAS	19158676, 26121197, 26611636, 29196474
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IMP	21487011
GO:0070700	Function	BMP receptor binding	IPI	24407287
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	12486103
GO:0071347	Process	Cellular response to interleukin-1	IDA	12486103
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	12486103
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IDA	12486103
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	14730312
GO:0072558	Component	NLRP1 inflammasome complex	IDA	12191486
GO:0072558	Component	NLRP1 inflammasome complex	IEA
GO:0072558	Component	NLRP1 inflammasome complex	IPI	17349957
GO:0072559	Component	NLRP3 inflammasome complex	IBA
GO:0072559	Component	NLRP3 inflammasome complex	IDA	15030775
GO:0072559	Component	NLRP3 inflammasome complex	IPI	29255148
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	14730312
GO:0097169	Component	AIM2 inflammasome complex	IDA	19158676
GO:0097169	Component	AIM2 inflammasome complex	IPI	24630722
GO:0097190	Process	Apoptotic signaling pathway	IMP	22267217
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IBA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	IBA
GO:0140608	Function	Cysteine-type endopeptidase activator activity	NAS	12019269
GO:0140632	Process	Canonical inflammasome complex assembly	IEA
GO:0140738	Component	NLRP6 inflammasome complex	IDA	30674671, 34678144
GO:0140738	Component	NLRP6 inflammasome complex	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IMP	24531343
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IPI	15817483
GO:2000406	Process	Positive regulation of T cell migration	IEA
GO:2000406	Process	Positive regulation of T cell migration	ISS
GO:2001238	Process	Positive regulation of extrinsic apoptotic signaling pathway	IDA	16964285
GO:2001242	Process	Regulation of intrinsic apoptotic signaling pathway	IDA	14730312

MIM	HGNC	e!Ensembl
606838	16608	ENSG00000103490

Q9ULZ3

Protein name

Apoptosis-associated speck-like protein containing a CARD (hASC) (Caspase recruitment domain-containing protein 5) (PYD and CARD domain-containing protein) (Target of methylation-induced silencing 1)

Protein function

Functions as a key mediator in apoptosis and inflammation (PubMed:11103777, PubMed:12646168, PubMed:15030775, PubMed:17349957, PubMed:17599095, PubMed:19158675, PubMed:19158676, PubMed:19234215, PubMed:19494289, PubMed:21487011, PubMed:24630722,

PDB

1UCP , 2KN6 , 3J63 , 5H8O , 6K99 , 6KI0 , 6N1H , 7E5B , 7KEU

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02758	PYRIN	7 → 83	PAAD/DAPIN/Pyrin domain	Domain
PF00619	CARD	112 → 195	Caspase recruitment domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Expressed

Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFY
LETYGAELTANVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA
ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQA
LRESQSYLVEDLERS

Sequence length

195

Interactions

View interactions

	KEGG		Reactome
	Necroptosis NOD-like receptor signaling pathway Cytosolic DNA-sensing pathway C-type lectin receptor signaling pathway Pathogenic Escherichia coli infection Shigellosis Salmonella infection Pertussis Legionellosis Yersinia infection Influenza A Lipid and atherosclerosis		CLEC7A/inflammasome pathway Neutrophil degranulation The NLRP3 inflammasome Purinergic signaling in leishmaniasis infection

PYCARD (PYD and CARD domain containing)