Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2901
Gene name	Glutamate ionotropic receptor kainate type subunit 5
Gene symbol	GRIK5
Synonyms (NCBI Gene)	EAA2GRIK2GluK5KA2
Chromosome	19
Chromosome location	19q13.2
Summary	This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane

Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045128	hsa-miR-186-5p	CLASH	23622248
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT2006796	hsa-miR-3150a-3p	CLIP-seq
MIRT2006797	hsa-miR-3175	CLIP-seq
MIRT2006798	hsa-miR-4274	CLIP-seq
MIRT2006799	hsa-miR-4293	CLIP-seq
MIRT2006800	hsa-miR-4468	CLIP-seq
MIRT2006801	hsa-miR-939	CLIP-seq
MIRT2450777	hsa-miR-4632	CLIP-seq
MIRT2450778	hsa-miR-572	CLIP-seq
MIRT2450779	hsa-miR-718	CLIP-seq

Show/Hide all (42)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004970	Function	Glutamate-gated receptor activity	IDA	8730589, 14511640
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14511640
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0007215	Process	Glutamate receptor signaling pathway	IEA
GO:0015276	Function	Ligand-gated monoatomic ion channel activity	IEA
GO:0015277	Function	Kainate selective glutamate receptor activity	IBA
GO:0015277	Function	Kainate selective glutamate receptor activity	IDA	1321949
GO:0015277	Function	Kainate selective glutamate receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA
GO:0032983	Component	Kainate selective glutamate receptor complex	IBA
GO:0032983	Component	Kainate selective glutamate receptor complex	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA
GO:0035249	Process	Synaptic transmission, glutamatergic	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042391	Process	Regulation of membrane potential	IEA
GO:0042734	Component	Presynaptic membrane	IBA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042995	Component	Cell projection	IEA
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0099505	Process	Regulation of presynaptic membrane potential	IEA
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IDA	18562611, 20026616
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IEA
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	IMP	18562611, 20026616
GO:0099507	Function	Ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential	NAS	18562611, 20026616
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IBA
GO:1904315	Function	Transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential	IEA

MIM	HGNC	e!Ensembl
600283	4583	ENSG00000105737

Q16478

Protein name

Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA-2) (KA2)

Protein function

Ionotropic glutamate receptor that functions as a cation-permeable ligand-gated ion channel, gated by L-glutamate and the glutamatergic agonist kainic acid. Cannot form functional channels on its own and produces channel activity only in heterom

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01094	ANF_receptor	39 → 384	Receptor family ligand binding region	Family
PF10613	Lig_chan-Glu_bd	415 → 529	Ligated ion channel L-glutamate- and glycine-binding site	Domain
PF00060	Lig_chan	543 → 815	Ligand-gated ion channel	Family

Sequence

MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE

Sequence length

980

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Glutamatergic synapse		Activation of Ca-permeable Kainate Receptor

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Colon adenocarcinoma	Likely benign	rs142317434	RCV005933485
GRIK5-related disorder	Uncertain significance; Likely benign; Benign	rs1555871638, rs145589136, rs2514270071, rs2514334509, rs192825138, rs144961263, rs146585971, rs199808612, rs368722769, rs782130099, rs140981334, rs369127460, rs142317434, rs3736109, rs150595206, rs141898879 View all (1 more)	RCV003397548 RCV003412216 RCV003408789 RCV003929751 RCV003911970 RCV003933914 RCV003917089 RCV003941508 RCV003939373 RCV003949439 RCV003944294 RCV003969193 RCV003964269 RCV003976342 RCV003978347 RCV003968005
Thyroid cancer, nonmedullary, 1	Likely benign	rs142317434	RCV005933486

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Bipolar Disorder	Associate	21771265, 28751646
Bohring syndrome	Associate	39614348
Epilepsy Temporal Lobe	Associate	22698689
Leukemia Lymphoma Adult T Cell	Associate	34446027
Leukemia Myeloid Acute	Associate	39614348
Melanoma	Associate	36553569
Paraparesis Tropical Spastic	Associate	34446027

GRIK5 (glutamate ionotropic receptor kainate type subunit 5)