Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2901
Gene name Gene Name - the full gene name approved by the HGNC.	Glutamate ionotropic receptor kainate type subunit 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRIK5
Synonyms (NCBI Gene) Gene synonyms aliases	EAA2, GRIK2, GluK5, KA2
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19q13.2
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane

Show/Hide all(14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045128	hsa-miR-186-5p	CLASH	23622248
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT515221	hsa-miR-126-5p	PAR-CLIP	23446348
MIRT515220	hsa-miR-4795-3p	PAR-CLIP	23446348
MIRT2006796	hsa-miR-3150a-3p	CLIP-seq
MIRT2006797	hsa-miR-3175	CLIP-seq
MIRT2006798	hsa-miR-4274	CLIP-seq
MIRT2006799	hsa-miR-4293	CLIP-seq
MIRT2006800	hsa-miR-4468	CLIP-seq
MIRT2006801	hsa-miR-939	CLIP-seq
MIRT2450777	hsa-miR-4632	CLIP-seq
MIRT2450778	hsa-miR-572	CLIP-seq
MIRT2450779	hsa-miR-718	CLIP-seq

Show/Hide all(33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005654	Component	Nucleoplasm	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005886	Component	Plasma membrane	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0006621	Process	Protein retention in ER lumen	IEA
GO:0008066	Function	Glutamate receptor activity	IBA	21873635
GO:0015276	Function	Ligand-gated ion channel activity	IBA	21873635
GO:0015277	Function	Kainate selective glutamate receptor activity	IDA	1321949
GO:0017124	Function	SH3 domain binding	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0031630	Process	Regulation of synaptic vesicle fusion to presynaptic active zone membrane	IEA
GO:0032983	Component	Kainate selective glutamate receptor complex	IEA
GO:0034220	Process	Ion transmembrane transport	IEA
GO:0035235	Process	Ionotropic glutamate receptor signaling pathway	IEA
GO:0035249	Process	Synaptic transmission, glutamatergic	IBA	21873635
GO:0038023	Function	Signaling receptor activity	IBA	21873635
GO:0042802	Function	Identical protein binding	IEA
GO:0043113	Process	Receptor clustering	IEA
GO:0043195	Component	Terminal bouton	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0045211	Component	Postsynaptic membrane	IBA	21873635
GO:0050804	Process	Modulation of chemical synaptic transmission	IBA	21873635
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099056	Component	Integral component of presynaptic membrane	IEA
GO:0099061	Component	Integral component of postsynaptic density membrane	IEA
GO:1904315	Function	Transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	21873635

MIM	HGNC	e!Ensembl
600283	4583	ENSG00000105737

Protein

UniProt ID

Q16478

Protein name

Glutamate receptor ionotropic, kainate 5 (GluK5) (Excitatory amino acid receptor 2) (EAA2) (Glutamate receptor KA-2) (KA2)

Protein function

Ionotropic glutamate receptor that functions as a cation-permeable ligand-gated ion channel, gated by L-glutamate and the glutamatergic agonist kainic acid. Cannot form functional channels on its own and produces channel activity only in heterom

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01094	ANF_receptor	39 → 384	Receptor family ligand binding region	Family
PF10613	Lig_chan-Glu_bd	415 → 529	Ligated ion channel L-glutamate- and glycine-binding site	Domain
PF00060	Lig_chan	543 → 815	Ligand-gated ion channel	Family

Sequence

MPAELLLLLIVAFASPSCQVLSSLRMAAILDDQTVCGRGERLALALAREQINGIIEVPAK
ARVEVDIFELQRDSQYETTDTMCQILPKGVVSVLGPSSSPASASTVSHICGEKEIPHIKV
GPEETPRLQYLRFASVSLYPSNEDVSLAVSRILKSFNYPSASLICAKAECLLRLEELVRG
FLISKETLSVRMLDDSRDPTPLLKEIRDDKVSTIIIDANASISHLILRKASELGMTSAFY
KYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTYLGP
ALSAALMFDAVHVVVSAVRELNRSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTG
RVEFNSKGQRTNYTLRILEKSRQGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVT
TILENPYVMRRPNFQALSGNERFEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGS
WTGMVGELINRKADLAVAAFTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFLD
PFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPV
GGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLAD
QTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFL
LESTMNEYHRRLNCNLTQIGGLLDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKR
KWWEGGRCPKEEDHRAKGLGMENIGGIFIVLICGLIIAVFVAVMEFIWSTRRSAESEEVS
VCQEMLQELRHAVSCRKTSRSRRRRRPGGPSRALLSLRAVREMRLSNGKLYSAGAGGDAG
SAHGGPQRLLDDPGPPSGARPAAPTPCTHVRVCQECRRIQALRASGAGAPPRGLGVPAEA
TSPPRPRPGPAGPRELAEHE

Sequence length

980

Interactions

View interactions

	KEGG		Reactome
	Neuroactive ligand-receptor interaction Glutamatergic synapse		Activation of Ca-permeable Kainate Receptor

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Leukemia	Leukemia, Myelocytic, Acute	rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297	27903959
Schizophrenia	Schizophrenia	rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346 View all (12 more)	18923069

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Bipolar Disorder	Bipolar Disorder			GWAS

Show/Hide Text Mining Associations (7)

Disease Name	Relationship Type	References
Associations from Text Mining
Bipolar Disorder	Associate	21771265, 28751646
Bohring syndrome	Associate	39614348
Epilepsy Temporal Lobe	Associate	22698689
Leukemia Lymphoma Adult T Cell	Associate	34446027
Leukemia Myeloid Acute	Associate	39614348
Melanoma	Associate	36553569
Paraparesis Tropical Spastic	Associate	34446027

GRIK5 (glutamate ionotropic receptor kainate type subunit 5)