RGCC (regulator of cell cycle)

Gene

• Entrez ID: 28984
• Gene name: Regulator of cell cycle
• Gene symbol: RGCC
• Synonyms (NCBI Gene): C13orf15, RGC-32, RGC32, bA157L14.2
• Chromosome: 13
• Chromosome location: 13q14.11
• Summary: This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017536	hsa-miR-335-5p	Microarray	18185580
MIRT029225	hsa-miR-26b-5p	Microarray	19088304

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001100	Process	Negative regulation of exit from mitosis	IDA	17146433
GO:0001818	Process	Negative regulation of cytokine production	IMP	19162005
GO:0001819	Process	Positive regulation of cytokine production	IMP	19162005
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	19652095
GO:0002430	Process	Complement receptor mediated signaling pathway	IMP	19162005
GO:0003331	Process	Positive regulation of extracellular matrix constituent secretion	IDA	19158077
GO:0005515	Function	Protein binding	IPI	19162005
GO:0005634	Component	Nucleus	IDA	11687586
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	11687586, 17146433
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	17146433
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	19158077
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17146433
GO:0010628	Process	Positive regulation of gene expression	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	19158077
GO:0016525	Process	Negative regulation of angiogenesis	IDA	19652095
GO:0019209	Function	Kinase activator activity	ISS
GO:0019887	Function	Protein kinase regulator activity	IMP	19162005
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IPI	11687586, 17146433
GO:0019901	Function	Protein kinase binding	ISS
GO:0030295	Function	Protein kinase activator activity	IBA
GO:0030295	Function	Protein kinase activator activity	IDA	11687586
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19158077
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	19162005
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	19652095
GO:0045931	Process	Positive regulation of mitotic cell cycle	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19158077
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	19158077
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070412	Function	R-SMAD binding	IPI	21307346
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095
GO:0072537	Process	Fibroblast activation	IEA
GO:0072537	Process	Fibroblast activation	ISS
GO:0090272	Process	Negative regulation of fibroblast growth factor production	IDA	19652095
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IDA	11687586
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	19162005
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	21307346
GO:1901991	Process	Negative regulation of mitotic cell cycle phase transition	IDA	17146433
GO:1904707	Process	Positive regulation of vascular associated smooth muscle cell proliferation	IDA	11687586
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	19158077
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	21307346
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	19652095

Other IDs

• MIM: 610077
• HGNC: 20369
• e!Ensembl: ENSG00000102760

Protein

• UniProt ID: Q9H4X1
• Protein name: Regulator of cell cycle RGCC (Response gene to complement 32 protein) (RGC-32)
• Protein function: Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic f
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15151	RGCC	1 → 137	Response gene to complement 32 protein family	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon,
• Sequence:

  MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
  KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
  KELEAFIADLDKTLASM

• Sequence length: 137

Pathways

KEGG:

Regulation of actin cytoskeleton

Reactome:

TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain