Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	28984
Gene name Gene Name - the full gene name approved by the HGNC.	Regulator of cell cycle
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	RGCC
Synonyms (NCBI Gene) Gene synonyms aliases	C13orf15, RGC-32, RGC32, bA157L14.2
Chromosome Chromosome number	13
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	13q14.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is thought to regulate cell cycle progression. It is induced by p53 in response to DNA damage, or by sublytic levels of complement system proteins that result in activation of the cell cycle. The encoded protein localizes to the cytoplasm during

Show/Hide all(2)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017536	hsa-miR-335-5p	Microarray	18185580
MIRT029225	hsa-miR-26b-5p	Microarray	19088304

Show/Hide all(46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001100	Process	Negative regulation of exit from mitosis	IDA	17146433
GO:0001818	Process	Negative regulation of cytokine production	IMP	19162005
GO:0001819	Process	Positive regulation of cytokine production	IMP	19162005
GO:0001937	Process	Negative regulation of endothelial cell proliferation	IDA	19652095
GO:0003331	Process	Positive regulation of extracellular matrix constituent secretion	IDA	19158077
GO:0005515	Function	Protein binding	IPI	19162005
GO:0005634	Component	Nucleus	IDA	11687586
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA	21873635
GO:0005737	Component	Cytoplasm	IDA	11687586, 17146433
GO:0005813	Component	Centrosome	IDA	17146433
GO:0005829	Component	Cytosol	TAS
GO:0006956	Process	Complement activation	IMP	19162005
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17146433
GO:0010628	Process	Positive regulation of gene expression	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IDA	21307346
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IMP	19158077
GO:0016525	Process	Negative regulation of angiogenesis	IDA	19652095
GO:0019901	Function	Protein kinase binding	IBA	21873635
GO:0019901	Function	Protein kinase binding	IPI	11687586, 17146433
GO:0019901	Function	Protein kinase binding	ISS
GO:0030295	Function	Protein kinase activator activity	IBA	21873635
GO:0030295	Function	Protein kinase activator activity	IDA	11687586
GO:0032147	Process	Activation of protein kinase activity	IEA
GO:0032967	Process	Positive regulation of collagen biosynthetic process	IDA	19158077
GO:0043537	Process	Negative regulation of blood vessel endothelial cell migration	IDA	19652095
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	11687586
GO:0045737	Process	Positive regulation of cyclin-dependent protein serine/threonine kinase activity	IMP	19162005
GO:0045840	Process	Positive regulation of mitotic nuclear division	IMP	19162005
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19158077
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	19158077
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	19158077
GO:0070412	Function	R-SMAD binding	IPI	21307346
GO:0071158	Process	Positive regulation of cell cycle arrest	IDA	17146433
GO:0071456	Process	Cellular response to hypoxia	IMP	19652095
GO:0071850	Process	Mitotic cell cycle arrest	IDA	17146433
GO:0072537	Process	Fibroblast activation	ISS
GO:0090272	Process	Negative regulation of fibroblast growth factor production	IDA	19652095
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IMP	19162005
GO:1901203	Process	Positive regulation of extracellular matrix assembly	IDA	21307346
GO:1901991	Process	Negative regulation of mitotic cell cycle phase transition	IDA	17146433
GO:2000048	Process	Negative regulation of cell-cell adhesion mediated by cadherin	IDA	19158077, 21307346
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IDA	19652095
GO:2000573	Process	Positive regulation of DNA biosynthetic process	ISS

MIM	HGNC	e!Ensembl
610077	20369	ENSG00000102760

Protein

UniProt ID

Q9H4X1

Protein name

Regulator of cell cycle RGCC (Response gene to complement 32 protein) (RGC-32)

Protein function

Modulates the activity of cell cycle-specific kinases. Enhances CDK1 activity. May contribute to the regulation of the cell cycle. May inhibit growth of glioma cells by promoting arrest of mitotic progression at the G2/M transition. Fibrogenic f

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15151	RGCC	1 → 137	Response gene to complement 32 protein family	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in brain, heart and liver (at protein level). Highly expressed in liver, skeletal muscle, kidney and pancreas. Detected at lower levels in heart, brain and placenta. Detected in aorta endothelial cells. Overexpressed in colon,

Sequence

MKPPAAQGSPAAAAAAAPALDSAAAEDLSDALCEFDAVLADFASPFHERHFHYEEHLERM
KRRSSASVSDSSGFSDSESADSLYRNSFSFSDEKLNSPTDSTPALLSATVTPQKAKLGDT
KELEAFIADLDKTLASM

Sequence length

137

Interactions

View interactions

	KEGG		Reactome
	Regulation of actin cytoskeleton		TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Multiple Sclerosis	Multiple Sclerosis			GWAS

Show/Hide Text Mining Associations (24)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Stimulate	19883641
Burkitt Lymphoma	Associate	22163048
Carcinogenesis	Associate	20862745
Carcinoma Non Small Cell Lung	Associate	20862745
Cardiomyopathy Dilated	Associate	29035886
Cartilage Diseases	Associate	17935617
Colonic Neoplasms	Associate	38143740
Colorectal Neoplasms	Associate	19883641
Diabetic Foot	Associate	39702546
Ectodermal Dysplasia Anhidrotic with Immunodeficiency Osteopetrosis and Lymphedema	Associate	31509193
Glycosuria Renal	Associate	19158077
Hereditary Breast and Ovarian Cancer Syndrome	Stimulate	22163048
HIV Infections	Associate	36123690
Inflammation	Inhibit	25418473
Job Syndrome	Stimulate	15932515
Leukemia	Associate	26308964
Lung Neoplasms	Associate	23715780
Lymphatic Metastasis	Associate	22458379
Multiple Sclerosis	Associate	26407760, 31509193
Neoplasm Metastasis	Associate	22458379
Neoplasms	Associate	19883641, 22458379, 23715780, 25418473, 29385536
Ovarian Neoplasms	Associate	20635389
Pancreatic Neoplasms	Associate	22458379
Precursor T Cell Lymphoblastic Leukemia Lymphoma	Associate	35974102

RGCC (regulator of cell cycle)