Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
28969
Gene name Gene Name - the full gene name approved by the HGNC.
Basic leucine zipper and W2 domains 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
BZW2
Synonyms (NCBI Gene) Gene synonyms aliases
5MP1, HSPC028, MST017, MSTP017
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7p21.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT032241 hsa-let-7b-5p Proteomics 18668040
MIRT045798 hsa-miR-191-5p CLASH 23622248
MIRT734919 hsa-let-7a-5p Luciferase reporter assay, Western blotting, qRT-PCR 33273832
MIRT828036 hsa-miR-1267 CLIP-seq
MIRT828037 hsa-miR-135a CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 21745818, 25147208
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IDA 21745818, 25468996
GO:0005737 Component Cytoplasm IEA
GO:0006417 Process Regulation of translation IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
619275 18808 ENSG00000136261
Protein
UniProt ID Q9Y6E2
Protein name eIF5-mimic protein 1 (Basic leucine zipper and W2 domain-containing protein 2)
Protein function Translation initiation regulator which represses non-AUG initiated translation and repeat-associated non-AUG (RAN) initiated translation by acting as a competitive inhibitor of eukaryotic translation initiation factor 5 (EIF5) function (PubMed:2
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02020 W2 338 415 eIF4-gamma/eIF5/eIF2-epsilon Family
Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLD
YRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIR
RYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKE
GIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLK
ELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTC
IMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAF
QKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESE
GEEN
Sequence length 419
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Dementia Dementia N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Adenocarcinoma Associate 38538258
Carcinoma Squamous Cell Associate 38538258
Colorectal Neoplasms Associate 37067340
Inflammatory Bowel Diseases Associate 35232999
Nasopharyngeal Carcinoma Associate 36608137
Neoplasm Metastasis Inhibit 37067340
Neoplasms Stimulate 37067340
Neoplasms Associate 38154691, 38538258
Recurrent respiratory papillomatosis Associate 36473368
Uterine Cervical Neoplasms Associate 38538258