Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2879
Gene name Gene Name - the full gene name approved by the HGNC.
Glutathione peroxidase 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPX4
Synonyms (NCBI Gene) Gene synonyms aliases
GPx-4, GSHPx-4, MCSP, PHGPx, SMDS, snGPx, snPHGPx
Disease Acronyms (UniProt) Disease acronyms from UniProt database
SMDS
Chromosome Chromosome number
19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
19p13.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of hydrogen peroxide, organic hydroperoxides and lipid hydroperoxides, and thereby protect cells against oxidative damage. Several isozy
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs769967246 C>A,T Pathogenic Coding sequence variant, synonymous variant, stop gained
rs775146234 G>A Pathogenic Intron variant
rs1599808202 GCACATGG>- Likely-pathogenic Frameshift variant, coding sequence variant
rs1599810980 TTTTC>- Pathogenic Intron variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT029349 hsa-miR-26b-5p Microarray 19088304
MIRT046107 hsa-miR-124-3p CLASH 23622248
MIRT735670 hsa-miR-182-5p Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization 33116120
MIRT755504 hsa-miR-324-3p Luciferase reporter assay, Western blotting, qRT-PCR, Immunoprecipitaion (IP), Flow cytometry 38947389
MIRT755995 hsa-miR?15a Luciferase reporter assay, Western blotting, qRT-PCR, RNA pull down assay 35069876
Transcription factors
Transcription factor Regulation Reference
CREM Unknown 15225122
TFAP2A Unknown 10428483
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IBA 21873635
GO:0004602 Function Glutathione peroxidase activity IBA 21873635
GO:0004602 Function Glutathione peroxidase activity IMP 17630701
GO:0004602 Function Glutathione peroxidase activity TAS 9705830
GO:0005515 Function Protein binding IPI 23355646
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138322 4556 ENSG00000167468
Protein
UniProt ID P36969
Protein name Phospholipid hydroperoxide glutathione peroxidase GPX4 (PHGPx) (EC 1.11.1.12) (Glutathione peroxidase 4) (GPx-4) (GSHPx-4) (EC 1.11.1.9)
Protein function Essential antioxidant peroxidase that directly reduces phospholipid hydroperoxide even if they are incorporated in membranes and lipoproteins (By similarity). Can also reduce cholesterol hydroperoxide and thymine hydroperoxide (By similarity). P
PDB 2GS3 , 2OBI , 5H5Q , 5H5R , 5H5S , 6ELW , 6HKQ , 6HN3 , 7L8K , 7L8L , 7L8M , 7L8Q , 7L8R , 7U4I , 7U4J , 7U4K , 7U4L , 7U4M , 7U4N , 8Q8J , 8Q8N
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 41 148 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Present primarily in testis. Expressed in platelets (at protein level) (PubMed:11115402). {ECO:0000269|PubMed:11115402, ECO:0000269|PubMed:9705830}.
Sequence
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYR
GFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMK
IQPKGKGILGNAIKWNFTKFLIDKNGCVVKRY
GPMEEPLVIEKDLPHYF
Sequence length 197
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glutathione metabolism
Arachidonic acid metabolism
Metabolic pathways
Ferroptosis
  Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Biosynthesis of D-series resolvins
Biosynthesis of E-series 18(S)-resolvins
Biosynthesis of aspirin-triggered D-series resolvins
Biosynthesis of E-series 18(R)-resolvins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Agenesis of corpus callosum Agenesis of corpus callosum rs754914260, rs1057519053, rs1057519056, rs1057519054, rs1057519055, rs1057519057, rs1384496494, rs1599017933
Atrial septal defect Atrial Septal Defects rs137852951, rs137852953, rs137852955, rs267607106, rs104893900, rs104893901, rs104893903, rs606231358, rs606231359, rs137852683, rs606231360, rs104893907, rs104894073, rs1585703301, rs104894074
View all (25 more)
Atrioventricular block Atrioventricular Block rs766840243, rs763809932
Basal cell neoplasm Basal Cell Neoplasm, Basal Cell Cancer rs587776578, rs587776579, rs2117956624, rs2118419579, rs2118365442, rs2118041703, rs2136689212, rs2118336503, rs1587692888, rs267606984, rs878853849, rs1554695110, rs1064793921, rs1588605348, rs1588568813 31174203
Unknown
Disease term Disease name Evidence References Source
Cirrhosis Cirrhosis 26042203 ClinVar
Congestive heart failure Congestive heart failure 20304815 ClinVar
Heart failure Heart failure, Left-Sided Heart Failure, Heart Failure, Right-Sided 20304815 ClinVar
Myocardial infarction Myocardial Failure 20304815 ClinVar
Associations from Text Mining
Disease Name Relationship Type References
Abortion Habitual Associate 27929073
Acute Disease Associate 36193742
Acute Lung Injury Associate 35910848, 36913799
Adenocarcinoma Associate 36035281
Adenocarcinoma of Lung Associate 33846793, 35866781, 37248295
Adrenal Gland Neoplasms Associate 32184394
AIDS Related Complex Associate 39796164
Alzheimer Disease Associate 35449212
Arthritis Rheumatoid Associate 35003389
Biliary Tract Neoplasms Associate 31590928