GPX2 (glutathione peroxidase 2)

Gene

• Entrez ID: 2877
• Gene name: Glutathione peroxidase 2
• Gene symbol: GPX2
• Synonyms (NCBI Gene): GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
• Chromosome: 14
• Chromosome location: 14q23.3
• Summary: The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005746	hsa-miR-17-3p	Luciferase reporter assay, Quantitative proteomic approach, Western blot	21203553
MIRT018920	hsa-miR-335-5p	Microarray	18185580
MIRT1032490	hsa-miR-1193	CLIP-seq
MIRT1032491	hsa-miR-1243	CLIP-seq
MIRT1032492	hsa-miR-1976	CLIP-seq
MIRT1032493	hsa-miR-3140-5p	CLIP-seq
MIRT1032494	hsa-miR-3169	CLIP-seq
MIRT1032495	hsa-miR-324-5p	CLIP-seq
MIRT1032496	hsa-miR-338-3p	CLIP-seq
MIRT1032497	hsa-miR-3664-3p	CLIP-seq
MIRT1032498	hsa-miR-3910	CLIP-seq
MIRT1032499	hsa-miR-4268	CLIP-seq
MIRT1032500	hsa-miR-4436a	CLIP-seq
MIRT1032501	hsa-miR-4493	CLIP-seq
MIRT1032502	hsa-miR-4515	CLIP-seq
MIRT1032503	hsa-miR-4519	CLIP-seq
MIRT1032504	hsa-miR-4530	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004601	Function	Peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	IBA
GO:0004602	Function	Glutathione peroxidase activity	IDA	8428933, 36608588
GO:0004602	Function	Glutathione peroxidase activity	IEA
GO:0004602	Function	Glutathione peroxidase activity	TAS	8428933
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8428933
GO:0005829	Component	Cytosol	IDA	8428933
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006979	Process	Response to oxidative stress	IEA
GO:0009055	Function	Electron transfer activity	TAS	8428933
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0045171	Component	Intercellular bridge	IDA
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IDA	36608588
GO:0047066	Function	Phospholipid-hydroperoxide glutathione peroxidase activity	IEA
GO:0072686	Component	Mitotic spindle	IDA
GO:0098869	Process	Cellular oxidant detoxification	IEA

Other IDs

• MIM: 138319
• HGNC: 4554
• e!Ensembl: ENSG00000176153

Protein

• UniProt ID: P18283
• Protein name: Glutathione peroxidase 2 (GPx-2) (GSHPx-2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2) (Phospholipid hydroperoxide glutathione pe
• Protein function: Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:36608588, PubMed:8428933). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl h
• PDB: 2HE3
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00255	GSHPx	8 → 120	Glutathione peroxidase	Family

• Tissue specificity: TISSUE SPECIFICITY: Mostly in liver and gastrointestinal tract, not found in heart or kidney. {ECO:0000269|PubMed:8428933}.
• Sequence:

  MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
  LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
  DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
  DIKRLLKVAI

• Sequence length: 190

Pathways

KEGG:

Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes

<