Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2877
Gene name Gene Name - the full gene name approved by the HGNC.
Glutathione peroxidase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPX2
Synonyms (NCBI Gene) Gene synonyms aliases
GI-GPx, GPRP, GPRP-2, GPx-2, GPx-GI, GSHPX-GI, GSHPx-2
Chromosome Chromosome number
14
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
14q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT005746 hsa-miR-17-3p Luciferase reporter assay, Quantitative proteomic approach, Western blot 21203553
MIRT018920 hsa-miR-335-5p Microarray 18185580
MIRT1032490 hsa-miR-1193 CLIP-seq
MIRT1032491 hsa-miR-1243 CLIP-seq
MIRT1032492 hsa-miR-1976 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IBA 21873635
GO:0004602 Function Glutathione peroxidase activity IBA 21873635
GO:0005737 Component Cytoplasm TAS 8428933
GO:0005829 Component Cytosol TAS
GO:0009055 Function Electron transfer activity TAS 8428933
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
138319 4554 ENSG00000176153
Protein
UniProt ID P18283
Protein name Glutathione peroxidase 2 (GPx-2) (GSHPx-2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2) (Phospholipid hydroperoxide glutathione pe
Protein function Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:36608588, PubMed:8428933). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl h
PDB 2HE3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 8 120 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Mostly in liver and gastrointestinal tract, not found in heart or kidney. {ECO:0000269|PubMed:8428933}.
Sequence
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK

DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases
  Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Breast cancer Malignant neoplasm of breast rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158
View all (309 more)
18056462
Breast carcinoma Breast Carcinoma rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451
View all (71 more)
18056462
Marfan syndrome Mammary Carcinoma, Human rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465
View all (942 more)
18056462
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 28631563
Adenoma Associate 30469315
Carcinogenesis Associate 21940907, 28631563
Carcinoma Hepatocellular Associate 28635398
Carcinoma Non Small Cell Lung Associate 35398749
Carcinoma Non Small Cell Lung Stimulate 36222298
Colonic Neoplasms Associate 36796200, 37834097
Colorectal Neoplasms Associate 28631563, 30469315, 36796200, 37075346, 37743483
Esophageal Squamous Cell Carcinoma Associate 27388201
Head and Neck Neoplasms Associate 37810778, 38132173