GPX2 (glutathione peroxidase 2)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 2877
Gene name Glutathione peroxidase 2
Gene symbol GPX2
Synonyms (NCBI Gene)
GI-GPxGPRPGPRP-2GPx-2GPx-GIGSHPX-GIGSHPx-2
Chromosome 14
Chromosome location 14q23.3
Summary The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozy
miRNA miRNA information provided by mirtarbase database.
17
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (17)
miRTarBase ID miRNA Experiments Reference
MIRT005746 hsa-miR-17-3p Luciferase reporter assayQuantitative proteomic approachWestern blot 21203553
MIRT018920 hsa-miR-335-5p Microarray 18185580
MIRT1032490 hsa-miR-1193 CLIP-seq
MIRT1032491 hsa-miR-1243 CLIP-seq
MIRT1032492 hsa-miR-1976 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (18)
GO ID Ontology Definition Evidence Reference
GO:0004601 Function Peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity IBA
GO:0004602 Function Glutathione peroxidase activity IDA 8428933, 36608588
GO:0004602 Function Glutathione peroxidase activity IEA
GO:0004602 Function Glutathione peroxidase activity TAS 8428933
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
138319 4554 ENSG00000176153
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P18283
Protein name Glutathione peroxidase 2 (GPx-2) (GSHPx-2) (EC 1.11.1.9) (Gastrointestinal glutathione peroxidase) (Glutathione peroxidase-gastrointestinal) (GPx-GI) (GSHPx-GI) (Glutathione peroxidase-related protein 2) (GPRP-2) (Phospholipid hydroperoxide glutathione pe
Protein function Catalyzes the reduction of hydroperoxides in a glutathione-dependent manner thus regulating cellular redox homeostasis (PubMed:36608588, PubMed:8428933). Can reduce small soluble hydroperoxides such as H2O2, cumene hydroperoxide and tert-butyl h
PDB 2HE3
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00255 GSHPx 8 → 120 Glutathione peroxidase Family
Tissue specificity TISSUE SPECIFICITY: Mostly in liver and gastrointestinal tract, not found in heart or kidney. {ECO:0000269|PubMed:8428933}.
Sequence 
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEP
DIKRLLKVAI
Sequence length 190
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG  Reactome
  Glutathione metabolism
Metabolic pathways
Thyroid hormone synthesis
Amyotrophic lateral sclerosis
Huntington disease
Pathways of neurodegeneration - multiple diseases 		  Synthesis of 12-eicosatetraenoic acid derivatives
Synthesis of 15-eicosatetraenoic acid derivatives
Detoxification of Reactive Oxygen Species
TP53 Regulates Metabolic Genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
8
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (8)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDER — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (26)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References Evidence Score
Adenocarcinoma of Lung Associate 28631563
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenoma Associate 30469315
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Associate 21940907, 28631563
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Associate 28635398
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Associate 35398749
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma Non Small Cell Lung Stimulate 36222298
★★★★★
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Associate 36796200, 37834097
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Associate 28631563, 30469315, 36796200, 37075346, 37743483
★★★★★
★☆☆☆☆
Found in Text Mining only
Esophageal Squamous Cell Carcinoma Associate 27388201
★★★★★
★☆☆☆☆
Found in Text Mining only
Head and Neck Neoplasms Associate 37810778, 38132173
★★★★★
★☆☆☆☆
Found in Text Mining only