Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2875
Gene name Gene Name - the full gene name approved by the HGNC.	Glutamic--pyruvic transaminase
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPT
Synonyms (NCBI Gene) Gene synonyms aliases	AAT1, ALT, ALT1, GPT1, SGPT
Chromosome Chromosome number	8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	8q24.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes cytosolic alanine aminotransaminase 1 (ALT1); also known as glutamate-pyruvate transaminase 1. This enzyme catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate and, therefore, play

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT1032467	hsa-miR-3065-3p	CLIP-seq
MIRT1032468	hsa-miR-455-3p	CLIP-seq
MIRT1032469	hsa-miR-4685-5p	CLIP-seq
MIRT1032470	hsa-miR-551a	CLIP-seq
MIRT1032471	hsa-miR-551b	CLIP-seq
MIRT2006294	hsa-miR-3064-3p	CLIP-seq
MIRT2006295	hsa-miR-3162-5p	CLIP-seq
MIRT2006296	hsa-miR-3649	CLIP-seq
MIRT2006297	hsa-miR-492	CLIP-seq
MIRT2542635	hsa-miR-1207-3p	CLIP-seq
MIRT2542636	hsa-miR-342-5p	CLIP-seq
MIRT2542637	hsa-miR-4651	CLIP-seq
MIRT2542638	hsa-miR-4664-5p	CLIP-seq
MIRT2542639	hsa-miR-4731-5p	CLIP-seq
MIRT2542640	hsa-miR-608	CLIP-seq
MIRT2542635	hsa-miR-1207-3p	CLIP-seq
MIRT2542636	hsa-miR-342-5p	CLIP-seq
MIRT2542637	hsa-miR-4651	CLIP-seq
MIRT2542638	hsa-miR-4664-5p	CLIP-seq
MIRT2542639	hsa-miR-4731-5p	CLIP-seq
MIRT2542640	hsa-miR-608	CLIP-seq

Show/Hide all(9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004021	Function	L-alanine:2-oxoglutarate aminotransferase activity	NAS	1931970
GO:0005829	Component	Cytosol	TAS
GO:0008652	Process	Cellular amino acid biosynthetic process	TAS
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0042853	Process	L-alanine catabolic process	IEA
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

MIM	HGNC	e!Ensembl
138200	4552	ENSG00000167701

Protein

UniProt ID

P24298

Protein name

Alanine aminotransferase 1 (ALT1) (EC 2.6.1.2) (Glutamate pyruvate transaminase 1) (GPT 1) (Glutamic--alanine transaminase 1) (Glutamic--pyruvic transaminase 1)

Protein function

Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Participates in cellular nitrogen metabolism and also in liver gluconeogenesis starting with precursors transported from skeletal muscles

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00155	Aminotran_1_2	83 → 484	Aminotransferase class I and II	Domain

Tissue specificity

TISSUE SPECIFICITY: Liver, kidney, heart, and skeletal muscles. Expressed at moderate levels in the adipose tissue. {ECO:0000269|PubMed:11863375}.

Sequence

MASSTGDRSQAVRHGLRAKVLTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPF
TEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL
GAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLLVAGEGHTRT
GVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVI
NPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPY
AGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDL
VVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQL
PPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLL
LEKLSRFHAKFTLEYS

Sequence length

496

Interactions

View interactions

	KEGG		Reactome
	Arginine biosynthesis Alanine, aspartate and glutamate metabolism Metabolic pathways Carbon metabolism 2-Oxocarboxylic acid metabolism Biosynthesis of amino acids		Alanine metabolism

GPT (glutamic--pyruvic transaminase)