Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2869
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor kinase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GRK5
Synonyms (NCBI Gene) Gene synonyms aliases	FP2025, GPRK5
Chromosome Chromosome number	10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	10q26.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their de

Show/Hide all(39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT036566	hsa-miR-941	CLASH	23622248
MIRT487507	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT487505	hsa-miR-4481	PAR-CLIP	23592263
MIRT487506	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT487504	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT487503	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT487507	hsa-miR-570-3p	PAR-CLIP	23592263
MIRT487505	hsa-miR-4481	PAR-CLIP	23592263
MIRT487506	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT487504	hsa-miR-1238-5p	PAR-CLIP	23592263
MIRT487503	hsa-miR-4758-5p	PAR-CLIP	23592263
MIRT1034929	hsa-miR-129-5p	CLIP-seq
MIRT1034930	hsa-miR-23a	CLIP-seq
MIRT1034931	hsa-miR-23b	CLIP-seq
MIRT1034932	hsa-miR-23c	CLIP-seq
MIRT1034933	hsa-miR-3161	CLIP-seq
MIRT1034934	hsa-miR-627	CLIP-seq
MIRT2239367	hsa-miR-1285	CLIP-seq
MIRT2239368	hsa-miR-132	CLIP-seq
MIRT2239369	hsa-miR-135a	CLIP-seq
MIRT2239370	hsa-miR-135b	CLIP-seq
MIRT2239371	hsa-miR-1587	CLIP-seq
MIRT2239372	hsa-miR-1909	CLIP-seq
MIRT2239373	hsa-miR-212	CLIP-seq
MIRT2239374	hsa-miR-2278	CLIP-seq
MIRT2239375	hsa-miR-3187-5p	CLIP-seq
MIRT2239376	hsa-miR-378g	CLIP-seq
MIRT2239377	hsa-miR-4283	CLIP-seq
MIRT2239378	hsa-miR-4486	CLIP-seq
MIRT2239379	hsa-miR-4492	CLIP-seq
MIRT2239380	hsa-miR-4498	CLIP-seq
MIRT2239381	hsa-miR-4656	CLIP-seq
MIRT2239382	hsa-miR-4675	CLIP-seq
MIRT2239383	hsa-miR-4741	CLIP-seq
MIRT2239384	hsa-miR-4804-3p	CLIP-seq
MIRT2239385	hsa-miR-604	CLIP-seq
MIRT2239386	hsa-miR-612	CLIP-seq
MIRT2239387	hsa-miR-647	CLIP-seq
MIRT2239388	hsa-miR-762	CLIP-seq

Show/Hide all(40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IBA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20124405
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004703	Function	G protein-coupled receptor kinase activity	IEA
GO:0005080	Function	Protein kinase C binding	TAS	9813065
GO:0005515	Function	Protein binding	IPI	17986524, 19008357, 19661922, 20124405
GO:0005524	Function	ATP binding	IEA
GO:0005543	Function	Phospholipid binding	TAS	9813065
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	7685906
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	14976207, 17986524
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	TAS	8626574
GO:0007217	Process	Tachykinin receptor signaling pathway	IDA	17986524
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	8288567
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	22099983
GO:0008289	Function	Lipid binding	IEA
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0043066	Process	Negative regulation of apoptotic process	IDA	20124405
GO:0045444	Process	Fat cell differentiation	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	14976207
GO:0047696	Function	Beta-adrenergic receptor kinase activity	IMP	20038610
GO:0047696	Function	Beta-adrenergic receptor kinase activity	TAS
GO:0051726	Process	Regulation of cell cycle	IMP	22099983

MIM	HGNC	e!Ensembl
600870	4544	ENSG00000198873

Protein

UniProt ID

P34947

Protein name

G protein-coupled receptor kinase 5 (EC 2.7.11.16) (G protein-coupled receptor kinase GRK5)

Protein function

Serine/threonine kinase that phosphorylates preferentially the activated forms of a variety of G-protein-coupled receptors (GPCRs). Such receptor phosphorylation initiates beta-arrestin-mediated receptor desensitization, internalization, and sig

PDB

4TNB , 4TND , 6PJX , 8UAP , 8UAQ , 9BRE , 9BRG , 9BRH , 9BRI , 9BRJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	52 → 170	Regulator of G protein signaling domain	Domain
PF00069	Pkinase	186 → 448	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in heart, placenta, lung > skeletal muscle > brain, liver, pancreas > kidney. {ECO:0000269|PubMed:7685906}.

Sequence

MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDLRRTIDRDYCSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VGQDLVSQTEEKLLQKPCKELFSACAQSVHEYLRGEPFHEYLDSMFFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSHKFSEEAKSIC
KMLLTKDAKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTLPPDLNRN
HPPEPPKKGLLQRLFKRQHQNNSKSSPSSKTSFNHHINSNHVSSNSTGSS

Sequence length

590

Interactions

View interactions

	KEGG		Reactome
	Chemokine signaling pathway Endocytosis Morphine addiction		G alpha (s) signalling events

Show/Hide Unknown Diseases (3)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Alzheimer disease	Alzheimer's disease or family history of Alzheimer's disease	N/A	N/A	GWAS
Diabetes	Type 2 diabetes	N/A	N/A	GWAS
Ischemic Stroke	Ischemic stroke	N/A	N/A	GWAS

Show/Hide Text Mining Associations (40)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma	Associate	26683690
Adenocarcinoma of Lung	Associate	31074380
Alzheimer Disease	Inhibit	34164834
Arthritis Infectious	Associate	16849637
Atrial Fibrillation	Associate	25049040, 26235218, 26860460
Blood Platelet Disorders	Associate	32649856
Breast Neoplasms	Associate	31664083, 34268929
Camurati Engelmann Syndrome	Stimulate	17125886
Carcinoma Renal Cell	Associate	36059531
Cardiomyopathy Dilated	Associate	27711126
Cardiovascular Diseases	Associate	32649856
Cerebral Infarction	Associate	36691064, 40304040
Colorectal Neoplasms	Associate	21575264, 22126303
Diabetes Mellitus	Associate	30907055
Diabetes Mellitus Type 2	Associate	22961080, 24594703, 29773828
Esophagitis	Associate	29628359
Glucose Intolerance	Associate	24594703
Heart Failure	Associate	19628119, 30104167, 30978507, 31554410, 32649856, 39276349
Heart Failure Systolic	Associate	25638254
Hypertension	Associate	21127457
Hypoglycemia	Associate	24594703
Lewy Body Disease	Associate	16957079
Macular Degeneration	Associate	16080115
Neoplasm Metastasis	Associate	31664083
Neoplasms	Associate	31074380, 32649856, 34116604, 34268929, 35885996
Nerve Degeneration	Associate	16957079
Obesity	Associate	29773828
Parkinson Disease	Associate	16957079, 40494419
Periodontitis	Associate	35179257
Plaque Amyloid	Associate	34164834
Prediabetic State	Associate	24594703
Pulmonary Embolism	Associate	32649856
Stomach Neoplasms	Associate	34034702
Stroke	Associate	21127457, 32649856
Stroke	Stimulate	36691064
Takotsubo Cardiomyopathy	Associate	23794609, 29514624
Temporomandibular Joint Disorders	Associate	22074755
Triple Negative Breast Neoplasms	Associate	31664083, 35412954
Urinary Bladder Neoplasms	Associate	34116604
Venous Thromboembolism	Associate	31420334, 32649856

GRK5 (G protein-coupled receptor kinase 5)