Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2861
Gene name Gene Name - the full gene name approved by the HGNC.	G protein-coupled receptor 37
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GPR37
Synonyms (NCBI Gene) Gene synonyms aliases	EDNRBL, PAELR, hET(B)R-LP
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q31.33
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into

Show/Hide all(6)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018084	hsa-miR-335-5p	Microarray	18185580
MIRT024744	hsa-miR-215-5p	Microarray	19074876
MIRT026544	hsa-miR-192-5p	Microarray	19074876
MIRT027626	hsa-miR-98-5p	Microarray	19088304
MIRT733478	hsa-miR-103a-3p	qRT-PCR	34184078
MIRT2005934	hsa-miR-3691-3p	CLIP-seq

Show/Hide all(51)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000151	Component	Ubiquitin ligase complex	IDA	12150907
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	9144577
GO:0005515	Function	Protein binding	IPI	14532270, 17519329, 28298427, 32814053
GO:0005737	Component	Cytoplasm	IDA	16443751
GO:0005783	Component	Endoplasmic reticulum	IDA	17059562
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11439185, 12150907
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9144577
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9144577
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	23690594
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	16443751
GO:0008188	Function	Neuropeptide receptor activity	IDA	16443751
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0008528	Function	G protein-coupled peptide receptor activity	IDA	23690594
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0009986	Component	Cell surface	IDA	16443751
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0016358	Process	Dendrite development	IEA
GO:0030165	Function	PDZ domain binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030544	Function	Hsp70 protein binding	IPI	12150907
GO:0031072	Function	Heat shock protein binding	IPI	12150907
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	11439185, 12150907, 17059562
GO:0031987	Process	Locomotion involved in locomotory behavior	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	IEA
GO:0034614	Process	Cellular response to reactive oxygen species	ISS	23690594
GO:0036505	Function	Prosaposin receptor activity	IBA
GO:0036505	Function	Prosaposin receptor activity	IDA	23690594
GO:0036505	Function	Prosaposin receptor activity	IEA
GO:0042277	Function	Peptide binding	IEA
GO:0042277	Function	Peptide binding	IPI	23690594
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042923	Function	Neuropeptide binding	IPI	16443751
GO:0042995	Component	Cell projection	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0043410	Process	Positive regulation of MAPK cascade	IBA
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	23690594
GO:0043410	Process	Positive regulation of MAPK cascade	IEA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	IEA
GO:0045964	Process	Positive regulation of dopamine metabolic process	IEA

MIM	HGNC	e!Ensembl
602583	4494	ENSG00000170775

Protein

UniProt ID

O15354

Protein name

Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR)

Protein function

G-protein-coupled receptor that plays a role in several physiological pathways such as resolution of inflammatory pain and oligodendrocyte differentiation (By similarity). Acts as a receptor for several ligands including prosaposin, osteocalcin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	278 → 549	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the

Sequence

MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC

Sequence length

613

Interactions

View interactions

	KEGG		Reactome
	Parkinson disease Pathways of neurodegeneration - multiple diseases		Peptide ligand-binding receptors G alpha (i) signalling events

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Lung adenocarcinoma	Lung adenocarcinoma	N/A	N/A	GWAS
Lymphocytic Leukemia	Chronic lymphocytic leukemia	N/A	N/A	GWAS

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Adenocarcinoma of Lung	Associate	34040139
Autism Spectrum Disorder	Associate	23251443
Breast Neoplasms	Associate	35045088
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress	Associate	35045088
Focal Cortical Dysplasia	Associate	34301297
Focal cortical dysplasia of Taylor	Associate	34301297
Glioma	Associate	37837549
Leukemia Myeloid Acute	Associate	11313277
Neoplasms	Associate	37837549
Parkinson Disease	Associate	21731658, 23251443
Parkinson Disease	Stimulate	33637132
Parkinsonian Disorders	Associate	33637132
Stomach Neoplasms	Associate	27036049

GPR37 (G protein-coupled receptor 37)