GPR37 (G protein-coupled receptor 37)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2861
Gene name Gene Name - the full gene name approved by the HGNC.
G protein-coupled receptor 37
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GPR37
Synonyms (NCBI Gene) Gene synonyms aliases
EDNRBL, PAELR, hET(B)R-LP
Chromosome Chromosome number
7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
7q31.33
Summary Summary of gene provided in NCBI Entrez Gene.
This gene is a member of the G protein-coupled receptor family. The encoded protein contains seven transmembrane domains and is found in cell and endoplasmic reticulum membranes. G protein-coupled receptors are involved in translating outside signals into
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT018084 hsa-miR-335-5p Microarray 18185580
MIRT024744 hsa-miR-215-5p Microarray 19074876
MIRT026544 hsa-miR-192-5p Microarray 19074876
MIRT027626 hsa-miR-98-5p Microarray 19088304
MIRT733478 hsa-miR-103a-3p qRT-PCR 34184078
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(33)
GO ID Ontology Definition Evidence Reference
GO:0000151 Component Ubiquitin ligase complex IDA 12150907
GO:0004930 Function G protein-coupled receptor activity TAS 9144577
GO:0005515 Function Protein binding IPI 14532270, 17519329, 28298427, 32814053
GO:0005737 Component Cytoplasm IDA 16443751
GO:0005783 Component Endoplasmic reticulum IDA 17059562
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
602583 4494 ENSG00000170775
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID O15354
Protein name Prosaposin receptor GPR37 (Endothelin B receptor-like protein 1) (ETBR-LP-1) (G-protein coupled receptor 37) (Parkin-associated endothelin receptor-like receptor) (PAELR)
Protein function G-protein-coupled receptor that plays a role in several physiological pathways such as resolution of inflammatory pain and oligodendrocyte differentiation (By similarity). Acts as a receptor for several ligands including prosaposin, osteocalcin
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 278 → 549 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in brain and spinal cord, and at lower levels in testis, placenta and liver, but no detectable expression observed in any other tissue. When overexpressed in cells, tends to become insoluble and unfolded. Accumulation of the
Sequence 
MRAPGALLARMSRLLLLLLLKVSASSALGVAPASRNETCLGESCAPTVIQRRGRDAWGPG
NSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPW
RWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLF
YWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNS
TNRRVRLKNPFYPLTQESYGAYAVMCLSVVIFGTGIIGNLAVMCIVCHNYYMRSISNSLL
ANLAFWDFLIIFFCLPLVIFHELTKKWLLEDFSCKIVPYIEVASLGVTTFTLCALCIDRF
RAATNVQMYYEMIENCSSTTAKLAVIWVGALLLALPEVVLRQLSKEDLGFSGRAPAERCI
IKISPDLPDTIYVLALTYDSARLWWYFGCYFCLPTLFTITCSLVTARKIRKAEKACTRGN
KRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAYMATGVSQQTMDLLNIISQFLLFF
KSCVTPVLLFCLCKPFSRAFMECCCCCCEECIQKSSTVTSDDNDNEYTTELELSPFSTIR
REMSTFASVGTHC
Sequence length 613
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Parkinson disease
Pathways of neurodegeneration - multiple diseases 		  Peptide ligand-binding receptors
G alpha (i) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Melanoma Cutaneous Melanoma rs121913315, rs121913323, rs137853080, rs137853081, rs121909232, rs121913388, rs104894094, rs104894095, rs104894097, rs104894098, rs104894099, rs104894109, rs137854599, rs11547328, rs104894340
View all (64 more)		 26237428
Show/Hide Unknown Diseases (3)
Unknown
Disease term Disease name Evidence References Source
Malignant melanoma of skin Malignant melanoma of skin of lower limb, Malignant melanoma of skin of upper limb 26237428 ClinVar
Lymphocytic Leukemia Lymphocytic Leukemia GWAS
Lung adenocarcinoma Lung adenocarcinoma Validation that loss of Tgfbr2 results in more aggressive and T cell-excluded KP lung tumors GWAS, CBGDA
Show/Hide Text Mining Associations (13)
Associations from Text Mining
Disease Name Relationship Type References
Adenocarcinoma of Lung Associate 34040139
Autism Spectrum Disorder Associate 23251443
Breast Neoplasms Associate 35045088
Choreoathetosis Hypothyroidism And Neonatal Respiratory Distress Associate 35045088
Focal Cortical Dysplasia Associate 34301297
Focal cortical dysplasia of Taylor Associate 34301297
Glioma Associate 37837549
Leukemia Myeloid Acute Associate 11313277
Neoplasms Associate 37837549
Parkinson Disease Associate 21731658, 23251443