GPR34 (G protein-coupled receptor 34)

Gene

• Entrez ID: 2857
• Gene name: G protein-coupled receptor 34
• Gene symbol: GPR34
• Synonyms (NCBI Gene): LPS1, LYPSR1
• Chromosome: X
• Chromosome location: Xp11.4
• Summary: G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate signals to the interior of the cell via activation of heterotrimeric G proteins that in turn activ

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018922	hsa-miR-335-5p	Microarray	18185580
MIRT733183	hsa-miR-4646-5p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33875796
MIRT1031327	hsa-miR-300	CLIP-seq
MIRT1031328	hsa-miR-381	CLIP-seq
MIRT1031329	hsa-miR-4719	CLIP-seq
MIRT2238522	hsa-miR-3671	CLIP-seq
MIRT2238523	hsa-miR-4699-3p	CLIP-seq
MIRT2238524	hsa-miR-4729	CLIP-seq
MIRT2238525	hsa-miR-607	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	TAS	10036181
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10036181
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10036181
GO:0016020	Component	Membrane	IEA
GO:0035589	Process	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA
GO:0045028	Function	G protein-coupled purinergic nucleotide receptor activity	IBA

Other IDs

• MIM: 300241
• HGNC: 4490
• e!Ensembl: ENSG00000171659

Protein

• UniProt ID: Q9UPC5
• Protein name: Probable G-protein coupled receptor 34
• Protein function: G-protein-coupled receptor of lysophosphatidylserine (LysoPS) that plays different roles in immune response (PubMed:16460680). Acts a damage-sensing receptor that triggers tissue repair upon recognition of dying neutrophils (By similarity). Mech
• PDB: 8IYX, 8IZ4, 8K4N, 8SAI, 8WRB, 8XBE, 8XBG, 8XBH, 8XBI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	71 → 327	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Broadly expressed. Highly expressed on mast cells (PubMed:16460680). {ECO:0000269|PubMed:16460680}.
• Sequence:

  MRSHTITMTTTSVSSWPYSSHRMRFITNHSDQPPQNFSATPNVTTCPMDEKLLSTVLTTS
  YSVIFIVGLVGNIIALYVFLGIHRKRNSIQIYLLNVAIADLLLIFCLPFRIMYHINQNKW
  TLGVILCKVVGTLFYMNMYISIILLGFISLDRYIKINRSIQQRKAITTKQSIYVCCIVWM
  LALGGFLTMIILTLKKGGHNSTMCFHYRDKHNAKGEAIFNFILVVMFWLIFLLIILSYIK
  IGKNLLRISKRRSKFPNSGKYATTARNSFIVLIIFTICFVPYHAFRFIYISSQLNVSSCY
  WKEIVHKTNEIMLVLSSFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFK
  PGYSLHDTSVAVKIQSSSKST

• Sequence length: 381