LPAR4 (lysophosphatidic acid receptor 4)

Gene

• Entrez ID: 2846
• Gene name: Lysophosphatidic acid receptor 4
• Gene symbol: LPAR4
• Synonyms (NCBI Gene): GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
• Chromosome: X
• Chromosome location: Xq21.1
• Summary: This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in m

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2032472	hsa-miR-3074-5p	CLIP-seq
MIRT2032473	hsa-miR-3117-5p	CLIP-seq
MIRT2032474	hsa-miR-3124-3p	CLIP-seq
MIRT2032475	hsa-miR-514	CLIP-seq
MIRT2032476	hsa-miR-514b-3p	CLIP-seq
MIRT2390288	hsa-miR-3616-5p	CLIP-seq
MIRT2390289	hsa-miR-3647-5p	CLIP-seq
MIRT2390290	hsa-miR-4670-3p	CLIP-seq
MIRT2390291	hsa-miR-573	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0035727	Function	Lysophosphatidic acid binding	IEA
GO:0070915	Function	Lysophosphatidic acid receptor activity	IBA
GO:0070915	Function	Lysophosphatidic acid receptor activity	IEA

Other IDs

• MIM: 300086
• HGNC: 4478
• e!Ensembl: ENSG00000147145

Protein

• UniProt ID: Q99677
• Protein name: Lysophosphatidic acid receptor 4 (LPA receptor 4) (LPA-4) (G-protein coupled receptor 23) (P2Y purinoceptor 9) (P2Y9) (P2Y5-like receptor) (Purinergic receptor 9)
• Protein function: Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this re
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	56 → 311	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: High expression in ovary. Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus and hippocampus. {ECO:0000269|PubMed:12724320}.
• Sequence:

  MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
  LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
  NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
  VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
  GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
  TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
  GGELMLESTF

• Sequence length: 370

Pathways

KEGG:

Rap1 signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Pathogenic Escherichia coli infection
Pathways in cancer

Reactome:

G alpha (q) signalling events
P2Y receptors