Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2846
Gene name Gene Name - the full gene name approved by the HGNC.	Lysophosphatidic acid receptor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	LPAR4
Synonyms (NCBI Gene) Gene synonyms aliases	GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Chromosome Chromosome number	X
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	Xq21.1
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a member of the lysophosphatidic acid receptor family. It may also be related to the P2Y receptors, a family of receptors that bind purine and pyrimidine nucleotides and are coupled to G proteins. The encoded protein may play a role in m

Show/Hide all(9)

miRTarBase ID	miRNA	Experiments
MIRT2032472	hsa-miR-3074-5p	CLIP-seq
MIRT2032473	hsa-miR-3117-5p	CLIP-seq
MIRT2032474	hsa-miR-3124-3p	CLIP-seq
MIRT2032475	hsa-miR-514	CLIP-seq
MIRT2032476	hsa-miR-514b-3p	CLIP-seq
MIRT2390288	hsa-miR-3616-5p	CLIP-seq
MIRT2390289	hsa-miR-3647-5p	CLIP-seq
MIRT2390290	hsa-miR-4670-3p	CLIP-seq
MIRT2390291	hsa-miR-573	CLIP-seq

Show/Hide all(11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA	21873635
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005887	Component	Integral component of plasma membrane	IBA	21873635
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IBA	21873635
GO:0035727	Function	Lysophosphatidic acid binding	IEA
GO:0043231	Component	Intracellular membrane-bounded organelle	IDA
GO:0051482	Process	Positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	21873635
GO:0070915	Function	Lysophosphatidic acid receptor activity	IBA	21873635

MIM	HGNC	e!Ensembl
300086	4478	ENSG00000147145

Protein

UniProt ID

Q99677

Protein name

Lysophosphatidic acid receptor 4 (LPA receptor 4) (LPA-4) (G-protein coupled receptor 23) (P2Y purinoceptor 9) (P2Y9) (P2Y5-like receptor) (Purinergic receptor 9)

Protein function

Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. Transduces a signal by increasing the intracellular calcium ions and by stimulating adenylyl cyclase activity. The rank order of potency for agonists of this re

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	56 → 311	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: High expression in ovary. Not detected in the brain regions thalamus, putamen, caudate, frontal cortex, pons, hypothalamus and hippocampus. {ECO:0000269|PubMed:12724320}.

Sequence

MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF

Sequence length

370

Interactions

View interactions

	KEGG		Reactome
	Rap1 signaling pathway Phospholipase D signaling pathway Neuroactive ligand-receptor interaction PI3K-Akt signaling pathway Regulation of actin cytoskeleton Pathogenic Escherichia coli infection Pathways in cancer		G alpha (q) signalling events P2Y receptors

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Papillary thyroid carcinoma	Papillary thyroid carcinoma	rs751409106	26941397

Show/Hide Text Mining Associations (8)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenomyosis	Stimulate	29178922
Breast Neoplasms	Associate	37372960
Lupus Erythematosus Systemic	Associate	36465614
Mesothelioma Malignant	Associate	18754873
Neoplasm Metastasis	Associate	29866927
Neoplasms	Associate	36646789, 37372960
Pancreatic Neoplasms	Stimulate	36646789
Squamous Cell Carcinoma of Head and Neck	Associate	23467751

LPAR4 (lysophosphatidic acid receptor 4)