GPR18 (G protein-coupled receptor 18)

Gene

• Entrez ID: 2841
• Gene name: G protein-coupled receptor 18
• Gene symbol: GPR18
• Synonyms (NCBI Gene): DRV2
• Chromosome: 13
• Chromosome location: 13q32.3

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002300	Process	CD8-positive, alpha-beta intraepithelial T cell differentiation	IEA
GO:0002305	Process	CD8-positive, gamma-delta intraepithelial T cell differentiation	IEA
GO:0002689	Process	Negative regulation of leukocyte chemotaxis	IEA
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	27994074
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	NAS	9205118
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IC	27994074
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	NAS	9205118
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17110384
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	9205118
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0050766	Process	Positive regulation of phagocytosis	IDA	27994074

Other IDs

• MIM: 602042
• HGNC: 4472
• e!Ensembl: ENSG00000125245

Protein

• UniProt ID: Q14330
• Protein name: N-arachidonyl glycine receptor (NAGly receptor) (G-protein coupled receptor 18)
• Protein function: G protein-coupled receptor (GPCR) that plays a role in diverse physiological processes particularly within the immune and nervous systems (PubMed:21732409, PubMed:26195725). Becomes active when triggered by various endogenous ligands including e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	39 → 286	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in midpiece of spermatozoon (at protein level) (PubMed:27572937). Most abundant in testis and spleen (PubMed:16844083). Highly expressed in CD4 and CD8-positive T-cells as well as CD19-positive B-cells (PubMed:16844083). {ECO
• Sequence:

  MITLNNQDQPVPFNSSHPDEYKIAALVFYSCIFIIGLFVNITALWVFSCTTKKRTTVTIY
  MMNVALVDLIFIMTLPFRMFYYAKDEWPFGEYFCQILGALTVFYPSIALWLLAFISADRY
  MAIVQPKYAKELKNTCKAVLACVGVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDIIY
  LKAVNVLNLTRLTFFFLIPLFIMIGCYLVIIHNLLHGRTSKLKPKVKEKSIRIIITLLVQ
  VLVCFMPFHICFAFLMLGTGENSYNPWGAFTTFLMNLSTCLDVILYYIVSKQFQARVISV
  MLYRNYLRSMRRKSFRSGSLRSLSNINSEML

• Sequence length: 331

Pathways

Reactome:

Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events