Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
284098
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphatidylinositol glycan anchor biosynthesis class W
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PIGW
Synonyms (NCBI Gene) Gene synonyms aliases
Gwt1, HPMRS5
Chromosome Chromosome number
17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
17q12
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is an inositol acyltransferase that acylates the inositol ring of phosphatidylinositol. This occurs in the endoplasmic reticulum and is a step in the biosynthesis of glycosylphosphatidylinositol (GPI), which anchors many c
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs147622852 C>T Likely-pathogenic Stop gained, coding sequence variant
rs200024253 A>G Pathogenic Missense variant, coding sequence variant
rs753385776 TTTG>- Likely-pathogenic Coding sequence variant, frameshift variant
rs1256773607 A>G Pathogenic Missense variant, coding sequence variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT547112 hsa-miR-200a-3p PAR-CLIP 21572407
MIRT547111 hsa-miR-141-3p PAR-CLIP 21572407
MIRT286845 hsa-miR-374b-5p PAR-CLIP 21572407
MIRT286843 hsa-miR-374a-5p PAR-CLIP 21572407
MIRT286847 hsa-miR-5583-3p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005789 Component Endoplasmic reticulum membrane IEA
GO:0005789 Component Endoplasmic reticulum membrane ISS
GO:0005789 Component Endoplasmic reticulum membrane TAS
GO:0006505 Process GPI anchor metabolic process IC 24367057
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610275 23213 ENSG00000277161
Protein
UniProt ID Q7Z7B1
Protein name Glucosaminyl-phosphatidylinositol-acyltransferase PIGW (GlcN-PI-acyltransferase) (EC 2.3.-.-) (Phosphatidylinositol-glycan biosynthesis class W protein) (PIG-W)
Protein function Acyltransferase that catalyzes the acyl transfer from an acyl-CoA at the 2-OH position of the inositol ring of glucosaminyl phosphatidylinositol (GlcN-PI) to generate glucosaminyl acyl phosphatidylinositol (GlcN-(acyl)PI) and participates in the
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06423 GWT1 301 463 GWT1 Family
Sequence
MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTD
FVVLIVPMVATLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNIS
LESEYNPAISCFRVITSAFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAM
VCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAIIKSIGYQEHLTEYGVHWNFFF
TIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLN
ANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISLFISLYVVQVN
VEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTN
KKHSESLVPEAERMEPSLCLITALNRKQLIFFLLSNITTGLIN
LMVDTLHSSTLWALFVV
NLYMFSNCLIVYVLYLQDKTVQFW
Sequence length 504
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
Metabolic pathways
  Synthesis of glycosylphosphatidylinositol (GPI)
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hyperphosphatasia With Mental Retardation Hyperphosphatasia with intellectual disability syndrome 5 rs587777733, rs1256773607 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Bipolar Disorder Bipolar I disorder N/A N/A GWAS
Hypercoagulability Syndrome hypercoagulability syndrome due to glycosylphosphatidylinositol deficiency N/A N/A ClinVar, GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abnormalities Multiple Associate 30813920
Carcinoma Squamous Cell Associate 36938730
Cognition Disorders Associate 30813920
Epilepsy Associate 30813920
Frontotemporal Dementia Associate 37979250
Hyperostosis corticalis deformans juvenilis Associate 30813920
Hyperphosphatasia with Mental Retardation Associate 30813920
Intellectual Disability Associate 30813920
Pneumonia Associate 30813920
Seizures Associate 30813920