Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
283927
Gene name Gene Name - the full gene name approved by the HGNC.
Nudix hydrolase 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
NUDT7
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q23.1
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this gene is a member of the Nudix hydrolase family. Nudix hydrolases eliminate potentially toxic nucleotide metabolites from the cell and regulate the concentrations and availability of many different nucleotide substrates, cofacto
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT715817 hsa-miR-590-3p HITS-CLIP 19536157
MIRT715816 hsa-miR-379-3p HITS-CLIP 19536157
MIRT715815 hsa-miR-411-3p HITS-CLIP 19536157
MIRT715813 hsa-miR-4502 HITS-CLIP 19536157
MIRT715814 hsa-miR-627-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000287 Function Magnesium ion binding IEA
GO:0000287 Function Magnesium ion binding ISS
GO:0003723 Function RNA binding IEA
GO:0005777 Component Peroxisome IEA
GO:0005777 Component Peroxisome ISS
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
609231 8054 ENSG00000140876
Protein
UniProt ID P0C024
Protein name Peroxisomal coenzyme A diphosphatase NUDT7 (EC 3.6.1.-) (EC 3.6.1.77) (Nucleoside diphosphate-linked moiety X motif 7) (Nudix motif 7)
Protein function Fatty acyl-coenzyme A (CoA) diphosphatase that hydrolyzes fatty acyl-CoA to yield acyl-4'-phosphopantetheine and adenosine 3',5'-bisphosphate (By similarity). Cleaves CoA, CoA esters and oxidized CoA with similar efficiencies (By similarity). Pr
PDB 5QGG , 5QGH , 5QGI , 5QGJ , 5QGK , 5QGL , 5QGM , 5QGN , 5QGO , 5QGP , 5QGQ , 5QGR , 5QGS , 5QGT , 5QGU , 5QGV , 5QGW , 5QGX , 5QGY , 5QGZ , 5QH0 , 5QH1 , 5QH2 , 5QH3 , 5QH4 , 5QH5 , 5QH6 , 5QH7 , 5QH8 , 5QH9 , 5QHA , 5QHB , 5QHC , 5QHE , 5QHF , 5QHG , 5QHH , 5T3P
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00293 NUDIX 38 166 NUDIX domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in liver, kidney, pancreas, pituitary, small intestine, spleen, heart and placenta. Weakly expressed in brain. {ECO:0000269|PubMed:11415433}.
Sequence
MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVR
SEKLRRAPGEVCFPGGKRDPTDMDDAATALREAQEEVGLRPHQVEVVCCLVPCLIDTDTL
ITPFVGLIDHNFQAQPNPAEVKDVFLVPLAYFLHPQVHDQHYVTRL
GHRFINHIFEYTNP
EDGVTYQIKGMTANLAVLVAFIILEKKPTFEVQFNLNDVLASSEELFLKVHKKATSRL
Sequence length 238
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Peroxisome   Peroxisomal lipid metabolism
Peroxisomal protein import
<