NPBWR2 (neuropeptides B and W receptor 2)

Gene

• Entrez ID: 2832
• Gene name: Neuropeptides B and W receptor 2
• Gene symbol: NPBWR2
• Synonyms (NCBI Gene): GPR8
• Chromosome: 20
• Chromosome location: 20q13.33
• Summary: The protein encoded by this gene is an integral membrane protein and G protein-coupled receptor. The encoded protein is similar in sequence to another G protein-coupled receptor (GPR7), and it is structurally similar to opioid and somatostatin receptors.

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	IEA
GO:0004985	Function	G protein-coupled opioid receptor activity	TAS	7590751
GO:0005515	Function	Protein binding	IPI	12401809, 25416956, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	12401809
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008188	Function	Neuropeptide receptor activity	IEA
GO:0016020	Component	Membrane	IC	12401809
GO:0016020	Component	Membrane	IEA
GO:0038003	Process	G protein-coupled opioid receptor signaling pathway	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA

Other IDs

• MIM: 600731
• HGNC: 4530
• e!Ensembl: ENSG00000125522

Protein

• UniProt ID: P48146
• Protein name: Neuropeptides B/W receptor type 2 (G-protein coupled receptor 8)
• Protein function: Interacts specifically with a number of opioid ligands. Receptor for neuropeptides B and W, which may be involved in neuroendocrine system regulation, food intake and the organization of other signals.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	62 → 316	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected at high levels in caudate nucleus, hippocampus and amygdala; at moderate levels in the adult brain, thalamus, parietal cortex, pituitary gland, adrenal gland and lymph nodes. {ECO:0000269|PubMed:12401809}.
• Sequence:

  MQAAGHPEPLDSRGSFSLPTMGANVSQDNGTGHNATFSEPLPFLYVLLPAVYSGICAVGL
  TGNTAVILVILRAPKMKTVTNVFILNLAVADGLFTLVLPVNIAEHLLQYWPFGELLCKLV
  LAVDHYNIFSSIYFLAVMSVDRYLVVLATVRSRHMPWRTYRGAKVASLCVWLGVTVLVLP
  FFSFAGVYSNELQVPSCGLSFPWPEQVWFKASRVYTLVLGFVLPVCTICVLYTDLLRRLR
  AVRLRSGAKALGKARRKVTVLVLVVLAVCLLCWTPFHLASVVALTTDLPQTPLVISMSYV
  ITSLSYANSCLNPFLYAFLDDNFRKNFRSILRC

• Sequence length: 333

Pathways

KEGG:

Neuroactive ligand-receptor interaction

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events