Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
2813
Gene name Gene Name - the full gene name approved by the HGNC.
Glycoprotein 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
GP2
Synonyms (NCBI Gene) Gene synonyms aliases
ZAP75
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16p12.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes an integral membrane protein that is secreted from intracellular zymogen granules and associates with the plasma membrane via glycosylphosphatidylinositol (GPI) linkage. The encoded protein binds pathogens such as enterobacteria, thereby
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT672307 hsa-miR-6750-3p HITS-CLIP 23824327
MIRT672306 hsa-miR-216a-5p HITS-CLIP 23824327
MIRT672305 hsa-miR-5197-5p HITS-CLIP 23824327
MIRT672304 hsa-miR-3680-5p HITS-CLIP 23824327
MIRT672303 hsa-miR-130a-3p HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005201 Function Extracellular matrix structural constituent IBA 21873635
GO:0005576 Component Extracellular region TAS
GO:0005615 Component Extracellular space IBA 21873635
GO:0005886 Component Plasma membrane TAS
GO:0009986 Component Cell surface IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
602977 4441 ENSG00000169347
Protein
UniProt ID P55259
Protein name Pancreatic secretory granule membrane major glycoprotein GP2 (Pancreatic zymogen granule membrane protein GP-2) (ZAP75)
Protein function Functions as an intestinal M-cell transcytotic receptor specific for type-I-piliated bacteria that participates in the mucosal immune response toward these bacteria. At the apical membrane of M-cells it binds fimH, a protein of the bacteria type
PDB 7P6R , 7P6S , 7P6T
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00100 Zona_pellucida 229 478 Zona pellucida-like domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in pancreas (at protein level) (PubMed:10760606, PubMed:8666297). Specifically expressed by M (microfold) cells which are atypical epithelial cells of the intestine (at protein level) (PubMed:19907495). {ECO:0000269|PubMed:10
Sequence
MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCF
DPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMW
LNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVP
RDPSTVEDKCEKACRPEEECLALNSTWGCFCRQDLNSSDVHSLQPQLDCGPREIKVKVDK
CLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQASACRNILERNQTHAIYKNT
LSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGEFIVRMALFQD
QNYTNPYEGDAVELSVESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRN
SCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVFLHCEIHLCDSLNEQCQPSCS
RS
QVRSEVPAIDLARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWPMVLLTVLLAWLF
Sequence length 537
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Post-translational modification: synthesis of GPI-anchored proteins
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Diabetes mellitus Diabetes Mellitus, Non-Insulin-Dependent rs587776515, rs61730328, rs606231121, rs606231122, rs79020217, rs77625743, rs78378398, rs606231123, rs1362648752, rs104893649, rs80356624, rs80356616, rs80356625, rs80356611, rs104894237
View all (293 more)
30718926
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Unknown
Disease term Disease name Evidence References Source
Diabetes Diabetes GWAS
Metabolic Syndrome Metabolic Syndrome GWAS
Coronary artery disease Coronary artery disease GWAS
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 16457694, 16596621, 32323103
Carcinoma Renal Cell Associate 35440542
Carotid Stenosis Associate 36894991
COVID 19 Associate 34322810
Crohn Disease Associate 24436141, 36608744
Crohn Disease Stimulate 27636380
Diabetes Gestational Associate 34326813
Diabetes Mellitus Associate 36894991
Diabetes Mellitus Type 2 Associate 34326813
Disease Associate 36608744