Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2810
Gene name Gene Name - the full gene name approved by the HGNC.	Stratifin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SFN
Synonyms (NCBI Gene) Gene synonyms aliases	YWHAS
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mit

Show/Hide all(111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024082	hsa-miR-1-3p	Proteomics	18668040
MIRT025569	hsa-miR-34a-5p	Proteomics	21566225
MIRT1341787	hsa-miR-1228	CLIP-seq
MIRT1341788	hsa-miR-1343	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341791	hsa-miR-2278	CLIP-seq
MIRT1341792	hsa-miR-2355-5p	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT1341794	hsa-miR-3125	CLIP-seq
MIRT1341795	hsa-miR-3160-5p	CLIP-seq
MIRT1341796	hsa-miR-3166	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT1341799	hsa-miR-3916	CLIP-seq
MIRT1341800	hsa-miR-4253	CLIP-seq
MIRT1341801	hsa-miR-4261	CLIP-seq
MIRT1341802	hsa-miR-431	CLIP-seq
MIRT1341803	hsa-miR-4323	CLIP-seq
MIRT1341804	hsa-miR-4325	CLIP-seq
MIRT1341805	hsa-miR-4446-5p	CLIP-seq
MIRT1341806	hsa-miR-4461	CLIP-seq
MIRT1341807	hsa-miR-4488	CLIP-seq
MIRT1341808	hsa-miR-4496	CLIP-seq
MIRT1341809	hsa-miR-4530	CLIP-seq
MIRT1341810	hsa-miR-4651	CLIP-seq
MIRT1341811	hsa-miR-4697-5p	CLIP-seq
MIRT1341812	hsa-miR-4726-3p	CLIP-seq
MIRT1341813	hsa-miR-4755-5p	CLIP-seq
MIRT1341814	hsa-miR-4757-5p	CLIP-seq
MIRT1341815	hsa-miR-494	CLIP-seq
MIRT1341816	hsa-miR-608	CLIP-seq
MIRT1341817	hsa-miR-615-5p	CLIP-seq
MIRT1341818	hsa-miR-625	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT1341821	hsa-miR-922	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1922968	hsa-miR-766	CLIP-seq
MIRT1341787	hsa-miR-1228	CLIP-seq
MIRT1341788	hsa-miR-1343	CLIP-seq
MIRT2101178	hsa-miR-140-5p	CLIP-seq
MIRT2101179	hsa-miR-1827	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT2101180	hsa-miR-2276	CLIP-seq
MIRT1341791	hsa-miR-2278	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT1341794	hsa-miR-3125	CLIP-seq
MIRT1341795	hsa-miR-3160-5p	CLIP-seq
MIRT1341796	hsa-miR-3166	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT2101181	hsa-miR-3656	CLIP-seq
MIRT2101182	hsa-miR-3685	CLIP-seq
MIRT2101183	hsa-miR-383	CLIP-seq
MIRT1341799	hsa-miR-3916	CLIP-seq
MIRT2101184	hsa-miR-421	CLIP-seq
MIRT2101185	hsa-miR-4252	CLIP-seq
MIRT1341800	hsa-miR-4253	CLIP-seq
MIRT2101186	hsa-miR-4257	CLIP-seq
MIRT1341801	hsa-miR-4261	CLIP-seq
MIRT1341802	hsa-miR-431	CLIP-seq
MIRT1341804	hsa-miR-4325	CLIP-seq
MIRT1341805	hsa-miR-4446-5p	CLIP-seq
MIRT1341806	hsa-miR-4461	CLIP-seq
MIRT2101187	hsa-miR-4466	CLIP-seq
MIRT1341807	hsa-miR-4488	CLIP-seq
MIRT1341808	hsa-miR-4496	CLIP-seq
MIRT1341809	hsa-miR-4530	CLIP-seq
MIRT1341810	hsa-miR-4651	CLIP-seq
MIRT1341811	hsa-miR-4697-5p	CLIP-seq
MIRT2101188	hsa-miR-4709-5p	CLIP-seq
MIRT2101189	hsa-miR-4722-3p	CLIP-seq
MIRT1341813	hsa-miR-4755-5p	CLIP-seq
MIRT2101190	hsa-miR-483-3p	CLIP-seq
MIRT1341815	hsa-miR-494	CLIP-seq
MIRT1341816	hsa-miR-608	CLIP-seq
MIRT1341817	hsa-miR-615-5p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT2101191	hsa-miR-658	CLIP-seq
MIRT2101192	hsa-miR-675	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT1922968	hsa-miR-766	CLIP-seq
MIRT1341821	hsa-miR-922	CLIP-seq
MIRT2325564	hsa-miR-145	CLIP-seq
MIRT2101179	hsa-miR-1827	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT2325565	hsa-miR-198	CLIP-seq
MIRT2325566	hsa-miR-2114	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT2325567	hsa-miR-3157-5p	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT2101183	hsa-miR-383	CLIP-seq
MIRT2101186	hsa-miR-4257	CLIP-seq
MIRT2325568	hsa-miR-4277	CLIP-seq
MIRT2325569	hsa-miR-4457	CLIP-seq
MIRT2325570	hsa-miR-4691-3p	CLIP-seq
MIRT2101190	hsa-miR-483-3p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT2394291	hsa-miR-1233	CLIP-seq
MIRT2394292	hsa-miR-129-3p	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TP53	Activation	10101800

Show/Hide all(30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000079	Process	Regulation of cyclin-dependent protein serine/threonine kinase activity	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	11574543
GO:0003334	Process	Keratinocyte development	IEA
GO:0005515	Function	Protein binding	IPI	11574543, 11697890, 15161933, 15657067, 15696159, 15778465, 15923258, 16189514, 16767219, 16799092, 16902409, 18339811, 18647389, 19172738, 19640509, 20005908, 20179209, 20206173, 20618440, 20843328, 21625211, 21988832, 23572552, 23752268, 24189400, 24510904, 24658140, 25416956, 258
GO:0005615	Component	Extracellular space	TAS	8515476
GO:0005634	Component	Nucleus	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	TAS	8515476
GO:0006977	Process	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS
GO:0007165	Process	Signal transduction	TAS	8515476
GO:0008426	Function	Protein kinase C inhibitor activity	TAS	8515476
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	11574543
GO:0010482	Process	Regulation of epidermal cell division	ISS
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031424	Process	Keratinization	IEA
GO:0042802	Function	Identical protein binding	IPI	15778465, 32296183
GO:0043154	Process	Negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	11574543
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045606	Process	Positive regulation of epidermal cell differentiation	ISS
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0061024	Process	Membrane organization	TAS
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0071901	Process	Negative regulation of protein serine/threonine kinase activity	IEA
GO:1900740	Process	Positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS

MIM	HGNC	e!Ensembl
601290	10773	ENSG00000175793

Protein

UniProt ID

P31947

Protein name

14-3-3 protein sigma (Epithelial cell marker protein 1) (Stratifin)

Protein function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed:15731107, PubMed:22634725, PubMed:28202711, PubMed:37797010). Binds to a large number of partners, usually by recognition

PDB

1YWT , 1YZ5 , 3IQJ , 3IQU , 3IQV , 3LW1 , 3MHR , 3O8I , 3P1N , 3P1O , 3P1P , 3P1Q , 3P1R , 3P1S , 3SMK , 3SML , 3SMM , 3SMN , 3SMO , 3SP5 , 3SPR , 3T0L , 3T0M , 3U9X , 3UX0 , 4DAT , 4DAU , 4DHM , 4DHN , 4DHO , 4DHP , 4DHQ , 4DHR , 4DHS , 4DHT , 4DHU , 4FL5 , 4FR3 , 4IEA , 4JC3 , 4JDD , 4QLI , 4Y32 , 4Y3B , 4Y5I , 5BTV , 5HF3 , 5LTW , 5LU1 , 5LU2 , 5MHC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00244	14-03-2003	9 → 231	14-3-3 protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Present mainly in tissues enriched in stratified squamous keratinizing epithelium. {ECO:0000269|PubMed:1390337}.

Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPQEPQS

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Cell cycle p53 signaling pathway Aldosterone-regulated sodium reabsorption		Activation of BAD and translocation to mitochondria RHO GTPases activate PKNs TP53 Regulates Metabolic Genes TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex Regulation of localization of FOXO transcription factors

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Carcinoma	Squamous cell carcinoma	rs121912654, rs555607708, rs786202962, rs1564055259	15274141
Esophagus neoplasm	Esophageal Neoplasms, Squamous cell carcinoma of esophagus, Malignant neoplasm of esophagus	rs28934578, rs121918714, rs1567556006, rs1575166666	15986332, 21517111
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	19381893

Show/Hide Text Mining Associations (66)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Inhibit	15257317
Adenocarcinoma	Associate	15696124, 15908786, 19596931
Alcoholism	Associate	21332526
Alzheimer Disease	Associate	37221295
Breast Neoplasms	Associate	10811911, 12878861, 15644556, 18379196, 19318578, 19729831, 20487521, 22192357, 22315970, 26179207
Carcinogenesis	Associate	15986332, 16886641, 22329840, 30926680
Carcinoma Adenoid Cystic	Associate	15292943
Carcinoma Ductal	Stimulate	19729831
Carcinoma Ductal Breast	Associate	19729831
Carcinoma Hepatocellular	Associate	24923353, 25226601, 27175590, 31432149, 33221766, 33391517
Carcinoma in Situ	Associate	18379196
Carcinoma Intraductal Noninfiltrating	Stimulate	19729831
Carcinoma Non Small Cell Lung	Stimulate	21755566
Carcinoma Pancreatic Ductal	Associate	15908786, 16886641, 19047086, 26894857, 32376891
Carcinoma Papillary	Stimulate	18440129
Carcinoma Papillary	Associate	24201220
Carcinoma Renal Cell	Inhibit	18548556
Carcinoma Squamous Cell	Stimulate	14736829
Carcinoma Squamous Cell	Associate	18950492, 19596931
Carcinoma Transitional Cell	Inhibit	14736829
Cholangiocarcinoma	Associate	28482619, 34903127
Chromosomal Instability	Associate	11003671
Chronic Disease	Associate	25041782
Colorectal Neoplasms	Associate	20421926, 23840115, 30478982, 9659898
Colorectal Neoplasms	Stimulate	21927014
Colorectal Neoplasms	Inhibit	27156963
Diabetes Mellitus	Associate	29768267, 30478982
Diabetes Mellitus Type 2	Associate	29768267, 30478982
Endometrial Neoplasms	Associate	28476021
Esophageal Squamous Cell Carcinoma	Associate	15986332, 21517111, 26346170
Esophageal Squamous Cell Carcinoma	Inhibit	24743601
Gastrointestinal Neoplasms	Inhibit	21132010
Hay Wells syndrome	Associate	12640112
Hematologic Neoplasms	Associate	18036248
Hereditary Breast and Ovarian Cancer Syndrome	Inhibit	15257317
Hypertelorism with esophageal abnormality and hypospadias	Associate	19509229
Inflammation	Associate	25041782
Leiomyoma	Inhibit	22329840
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	19220809
Lung Neoplasms	Associate	21755566
Lymphatic Metastasis	Associate	19642975, 21040574
Lymphoma	Stimulate	18036248
Melanoma	Associate	19473536, 19642975
Nasopharyngeal Carcinoma	Associate	26409455
Neoplasm Metastasis	Associate	28482619, 33391517, 34903127
Neoplasms	Inhibit	14736829, 15644556, 15986332, 17172876, 17764565, 18950492, 19473536, 19642975, 21935479, 23774214, 24201220, 24234332, 27261462, 40004538
Neoplasms	Associate	15257317, 15292943, 15778465, 15908786, 16786000, 18036248, 18548556, 20826914, 21249227, 21755566, 25041782, 26179207, 27156963, 28087741, 28476021 View all (7 more)
Neoplasms	Stimulate	24923353
Non Muscle Invasive Bladder Neoplasms	Stimulate	23374291
Osteosarcoma	Associate	24474250
Ovarian Neoplasms	Inhibit	15257317, 24201220
Ovarian Neoplasms	Associate	21249227
Ovarian Neoplasms	Stimulate	30926680
Pancreatic Intraductal Neoplasms	Associate	16886641
Pancreatic Neoplasms	Associate	12651607, 15696124, 15908786, 16886641, 19047086, 25409614
Pancreatic Neoplasms	Stimulate	21040574, 35547358
Personality Disorders	Associate	27156963
Prostatic Neoplasms	Inhibit	16786000
Squamous Cell Carcinoma of Head and Neck	Associate	18339795, 32048621, 32468250, 40004538
Stomach Neoplasms	Associate	20826914, 24185104
Thyroid Neoplasms	Associate	18440129
Tongue Neoplasms	Associate	26036631
Urinary Bladder Neoplasms	Associate	14736829, 18702824, 23374291, 24234332
Uterine Cervical Dysplasia	Inhibit	24743601
Vulvar Neoplasms	Associate	18950492
Warburg Sjo Fledelius syndrome	Associate	24923353

SFN (stratifin)