Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2810
Gene name Gene Name - the full gene name approved by the HGNC.	Stratifin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SFN
Synonyms (NCBI Gene) Gene synonyms aliases	YWHAS
Chromosome Chromosome number	1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	1p36.11
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a cell cycle checkpoint protein. The encoded protein binds to translation and initiation factors and functions as a regulator of mitotic translation. In response to DNA damage this protein plays a role in preventing DNA errors during mit

Show/Hide all(111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024082	hsa-miR-1-3p	Proteomics	18668040
MIRT025569	hsa-miR-34a-5p	Proteomics	21566225
MIRT1341787	hsa-miR-1228	CLIP-seq
MIRT1341788	hsa-miR-1343	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341791	hsa-miR-2278	CLIP-seq
MIRT1341792	hsa-miR-2355-5p	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT1341794	hsa-miR-3125	CLIP-seq
MIRT1341795	hsa-miR-3160-5p	CLIP-seq
MIRT1341796	hsa-miR-3166	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT1341799	hsa-miR-3916	CLIP-seq
MIRT1341800	hsa-miR-4253	CLIP-seq
MIRT1341801	hsa-miR-4261	CLIP-seq
MIRT1341802	hsa-miR-431	CLIP-seq
MIRT1341803	hsa-miR-4323	CLIP-seq
MIRT1341804	hsa-miR-4325	CLIP-seq
MIRT1341805	hsa-miR-4446-5p	CLIP-seq
MIRT1341806	hsa-miR-4461	CLIP-seq
MIRT1341807	hsa-miR-4488	CLIP-seq
MIRT1341808	hsa-miR-4496	CLIP-seq
MIRT1341809	hsa-miR-4530	CLIP-seq
MIRT1341810	hsa-miR-4651	CLIP-seq
MIRT1341811	hsa-miR-4697-5p	CLIP-seq
MIRT1341812	hsa-miR-4726-3p	CLIP-seq
MIRT1341813	hsa-miR-4755-5p	CLIP-seq
MIRT1341814	hsa-miR-4757-5p	CLIP-seq
MIRT1341815	hsa-miR-494	CLIP-seq
MIRT1341816	hsa-miR-608	CLIP-seq
MIRT1341817	hsa-miR-615-5p	CLIP-seq
MIRT1341818	hsa-miR-625	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT1341821	hsa-miR-922	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1922968	hsa-miR-766	CLIP-seq
MIRT1341787	hsa-miR-1228	CLIP-seq
MIRT1341788	hsa-miR-1343	CLIP-seq
MIRT2101178	hsa-miR-140-5p	CLIP-seq
MIRT2101179	hsa-miR-1827	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT2101180	hsa-miR-2276	CLIP-seq
MIRT1341791	hsa-miR-2278	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT1341794	hsa-miR-3125	CLIP-seq
MIRT1341795	hsa-miR-3160-5p	CLIP-seq
MIRT1341796	hsa-miR-3166	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT2101181	hsa-miR-3656	CLIP-seq
MIRT2101182	hsa-miR-3685	CLIP-seq
MIRT2101183	hsa-miR-383	CLIP-seq
MIRT1341799	hsa-miR-3916	CLIP-seq
MIRT2101184	hsa-miR-421	CLIP-seq
MIRT2101185	hsa-miR-4252	CLIP-seq
MIRT1341800	hsa-miR-4253	CLIP-seq
MIRT2101186	hsa-miR-4257	CLIP-seq
MIRT1341801	hsa-miR-4261	CLIP-seq
MIRT1341802	hsa-miR-431	CLIP-seq
MIRT1341804	hsa-miR-4325	CLIP-seq
MIRT1341805	hsa-miR-4446-5p	CLIP-seq
MIRT1341806	hsa-miR-4461	CLIP-seq
MIRT2101187	hsa-miR-4466	CLIP-seq
MIRT1341807	hsa-miR-4488	CLIP-seq
MIRT1341808	hsa-miR-4496	CLIP-seq
MIRT1341809	hsa-miR-4530	CLIP-seq
MIRT1341810	hsa-miR-4651	CLIP-seq
MIRT1341811	hsa-miR-4697-5p	CLIP-seq
MIRT2101188	hsa-miR-4709-5p	CLIP-seq
MIRT2101189	hsa-miR-4722-3p	CLIP-seq
MIRT1341813	hsa-miR-4755-5p	CLIP-seq
MIRT2101190	hsa-miR-483-3p	CLIP-seq
MIRT1341815	hsa-miR-494	CLIP-seq
MIRT1341816	hsa-miR-608	CLIP-seq
MIRT1341817	hsa-miR-615-5p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT2101191	hsa-miR-658	CLIP-seq
MIRT2101192	hsa-miR-675	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT1922968	hsa-miR-766	CLIP-seq
MIRT1341821	hsa-miR-922	CLIP-seq
MIRT2325564	hsa-miR-145	CLIP-seq
MIRT2101179	hsa-miR-1827	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT2325565	hsa-miR-198	CLIP-seq
MIRT2325566	hsa-miR-2114	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341793	hsa-miR-31	CLIP-seq
MIRT2325567	hsa-miR-3157-5p	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT2101183	hsa-miR-383	CLIP-seq
MIRT2101186	hsa-miR-4257	CLIP-seq
MIRT2325568	hsa-miR-4277	CLIP-seq
MIRT2325569	hsa-miR-4457	CLIP-seq
MIRT2325570	hsa-miR-4691-3p	CLIP-seq
MIRT2101190	hsa-miR-483-3p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq
MIRT2394291	hsa-miR-1233	CLIP-seq
MIRT2394292	hsa-miR-129-3p	CLIP-seq
MIRT1341789	hsa-miR-1909	CLIP-seq
MIRT1341790	hsa-miR-214	CLIP-seq
MIRT1341797	hsa-miR-329	CLIP-seq
MIRT1341798	hsa-miR-3619-5p	CLIP-seq
MIRT1341819	hsa-miR-642a	CLIP-seq
MIRT1341820	hsa-miR-761	CLIP-seq

Transcription factors

Show/Hide all(1)

Transcription factor	Regulation	Reference
TP53	Activation	10101800

Show/Hide all(56)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	11574543
GO:0003334	Process	Keratinocyte development	IEA
GO:0005515	Function	Protein binding	IPI	11574543, 11697890, 15161933, 15657067, 15696159, 15778465, 15923258, 16189514, 16511572, 16672277, 16767219, 16799092, 16902409, 18339811, 18647389, 19172738, 19640509, 20005908, 20179209, 20206173, 20618440, 20843328, 21625211, 21988832, 23572552, 23752268, 24124604, 24189400, 245
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	8515476
GO:0005634	Component	Nucleus	IDA	31906564
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24124604
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	37797010
GO:0005829	Component	Cytosol	IDA	31906564
GO:0005829	Component	Cytosol	TAS
GO:0006469	Process	Negative regulation of protein kinase activity	TAS	8515476
GO:0006611	Process	Protein export from nucleus	IEA
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	TAS	8515476
GO:0008104	Process	Intracellular protein localization	IBA
GO:0008426	Function	Protein kinase C inhibitor activity	TAS	8515476
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IDA	11574543
GO:0010482	Process	Regulation of epidermal cell division	IEA
GO:0010482	Process	Regulation of epidermal cell division	ISS
GO:0010839	Process	Negative regulation of keratinocyte proliferation	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0022407	Process	Regulation of cell-cell adhesion	IMP	29678907
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0031424	Process	Keratinization	IEA
GO:0032880	Process	Regulation of protein localization	IMP	29678907
GO:0042742	Process	Defense response to bacterium	IDA	31268602
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15778465, 32296183, 36931259
GO:0043588	Process	Skin development	IEA
GO:0043616	Process	Keratinocyte proliferation	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045606	Process	Positive regulation of epidermal cell differentiation	IEA
GO:0045606	Process	Positive regulation of epidermal cell differentiation	ISS
GO:0045785	Process	Positive regulation of cell adhesion	IMP	24124604
GO:0045824	Process	Negative regulation of innate immune response	IDA	37797010
GO:0046827	Process	Positive regulation of protein export from nucleus	IEA
GO:0050815	Function	Phosphoserine residue binding	IDA	37797010
GO:0051219	Function	Phosphoprotein binding	IEA
GO:0051715	Process	Cytolysis in another organism	IDA	31268602
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0072089	Process	Stem cell proliferation	IEA
GO:0140311	Function	Protein sequestering activity	IDA	37797010
GO:0141156	Process	CAMP/PKA signal transduction	IEA
GO:0160075	Process	Non-canonical inflammasome complex assembly	IDA	31268602
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	24124604
GO:1903829	Process	Positive regulation of protein localization	IMP	24124604
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
601290	10773	ENSG00000175793

Protein

UniProt ID

P31947

Protein name

14-3-3 protein sigma (Epithelial cell marker protein 1) (Stratifin)

Protein function

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways (PubMed:15731107, PubMed:22634725, PubMed:28202711, PubMed:37797010). Binds to a large number of partners, usually by recognition

PDB

1YWT , 1YZ5 , 3IQJ , 3IQU , 3IQV , 3LW1 , 3MHR , 3O8I , 3P1N , 3P1O , 3P1P , 3P1Q , 3P1R , 3P1S , 3SMK , 3SML , 3SMM , 3SMN , 3SMO , 3SP5 , 3SPR , 3T0L , 3T0M , 3U9X , 3UX0 , 4DAT , 4DAU , 4DHM , 4DHN , 4DHO , 4DHP , 4DHQ , 4DHR , 4DHS , 4DHT , 4DHU , 4FL5 , 4FR3 , 4IEA , 4JC3 , 4JDD , 4QLI , 4Y32 , 4Y3B , 4Y5I , 5BTV , 5HF3 , 5LTW , 5LU1 , 5LU2 , 5MHC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00244	14-03-2003	9 → 231	14-3-3 protein	Domain

Tissue specificity

TISSUE SPECIFICITY: Present mainly in tissues enriched in stratified squamous keratinizing epithelium. {ECO:0000269|PubMed:1390337}.

Sequence

MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGG
EAPQEPQS

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Cell cycle p53 signaling pathway Aldosterone-regulated sodium reabsorption		Activation of BAD and translocation to mitochondria RHO GTPases activate PKNs TP53 Regulates Metabolic Genes TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Chk1/Chk2(Cds1) mediated inactivation of Cyclin B:Cdk1 complex Regulation of localization of FOXO transcription factors

SFN (stratifin)