Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2791
Gene name Gene Name - the full gene name approved by the HGNC.	G protein subunit gamma 11
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GNG11
Synonyms (NCBI Gene) Gene synonyms aliases	GNGT11, HG3H1
Chromosome Chromosome number	7
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	7q21.3
Summary Summary of gene provided in NCBI Entrez Gene.	This gene is a member of the guanine nucleotide-binding protein (G protein) gamma family and encodes a lipid-anchored, cell membrane protein. As a member of the heterotrimeric G protein complex, this protein plays a role in this transmembrane signaling sy

Show/Hide all(67)

miRTarBase ID	miRNA	Experiments
MIRT2236514	hsa-miR-127-5p	CLIP-seq
MIRT2236515	hsa-miR-3942-5p	CLIP-seq
MIRT2236516	hsa-miR-4703-5p	CLIP-seq
MIRT2540245	hsa-miR-1265	CLIP-seq
MIRT2540246	hsa-miR-1298	CLIP-seq
MIRT2540247	hsa-miR-150	CLIP-seq
MIRT2540248	hsa-miR-153	CLIP-seq
MIRT2540249	hsa-miR-217	CLIP-seq
MIRT2540250	hsa-miR-2392	CLIP-seq
MIRT2540251	hsa-miR-3126-3p	CLIP-seq
MIRT2540252	hsa-miR-3140-3p	CLIP-seq
MIRT2540253	hsa-miR-3168	CLIP-seq
MIRT2540254	hsa-miR-3174	CLIP-seq
MIRT2540255	hsa-miR-3192	CLIP-seq
MIRT2540256	hsa-miR-3653	CLIP-seq
MIRT2540257	hsa-miR-3658	CLIP-seq
MIRT2540258	hsa-miR-3667-3p	CLIP-seq
MIRT2540259	hsa-miR-3907	CLIP-seq
MIRT2540260	hsa-miR-4314	CLIP-seq
MIRT2540261	hsa-miR-4422	CLIP-seq
MIRT2540262	hsa-miR-4436b-5p	CLIP-seq
MIRT2540263	hsa-miR-4646-5p	CLIP-seq
MIRT2540264	hsa-miR-4713-5p	CLIP-seq
MIRT2540265	hsa-miR-4720-3p	CLIP-seq
MIRT2540266	hsa-miR-4775	CLIP-seq
MIRT2540267	hsa-miR-4781-3p	CLIP-seq
MIRT2540268	hsa-miR-4789-5p	CLIP-seq
MIRT2540269	hsa-miR-4804-3p	CLIP-seq
MIRT2540270	hsa-miR-495	CLIP-seq
MIRT2540271	hsa-miR-532-3p	CLIP-seq
MIRT2540272	hsa-miR-548u	CLIP-seq
MIRT2540273	hsa-miR-651	CLIP-seq
MIRT2540274	hsa-miR-767-3p	CLIP-seq
MIRT2540275	hsa-miR-921	CLIP-seq
MIRT2540245	hsa-miR-1265	CLIP-seq
MIRT2540246	hsa-miR-1298	CLIP-seq
MIRT2540247	hsa-miR-150	CLIP-seq
MIRT2540248	hsa-miR-153	CLIP-seq
MIRT2540249	hsa-miR-217	CLIP-seq
MIRT2540250	hsa-miR-2392	CLIP-seq
MIRT2540251	hsa-miR-3126-3p	CLIP-seq
MIRT2540252	hsa-miR-3140-3p	CLIP-seq
MIRT2681741	hsa-miR-3153	CLIP-seq
MIRT2540253	hsa-miR-3168	CLIP-seq
MIRT2540254	hsa-miR-3174	CLIP-seq
MIRT2540255	hsa-miR-3192	CLIP-seq
MIRT2540256	hsa-miR-3653	CLIP-seq
MIRT2540257	hsa-miR-3658	CLIP-seq
MIRT2540258	hsa-miR-3667-3p	CLIP-seq
MIRT2540259	hsa-miR-3907	CLIP-seq
MIRT2540260	hsa-miR-4314	CLIP-seq
MIRT2540261	hsa-miR-4422	CLIP-seq
MIRT2540262	hsa-miR-4436b-5p	CLIP-seq
MIRT2540263	hsa-miR-4646-5p	CLIP-seq
MIRT2681742	hsa-miR-4668-5p	CLIP-seq
MIRT2540264	hsa-miR-4713-5p	CLIP-seq
MIRT2540265	hsa-miR-4720-3p	CLIP-seq
MIRT2540266	hsa-miR-4775	CLIP-seq
MIRT2540267	hsa-miR-4781-3p	CLIP-seq
MIRT2540268	hsa-miR-4789-5p	CLIP-seq
MIRT2540269	hsa-miR-4804-3p	CLIP-seq
MIRT2540270	hsa-miR-495	CLIP-seq
MIRT2540271	hsa-miR-532-3p	CLIP-seq
MIRT2540272	hsa-miR-548u	CLIP-seq
MIRT2540273	hsa-miR-651	CLIP-seq
MIRT2540274	hsa-miR-767-3p	CLIP-seq
MIRT2540275	hsa-miR-921	CLIP-seq

Show/Hide all(8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	TAS	7665596
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005834	Component	Heterotrimeric G-protein complex	IBA	21873635
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	TAS	7665596
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA	21873635
GO:0031680	Component	G-protein beta/gamma-subunit complex	IBA	21873635
GO:0031681	Function	G-protein beta-subunit binding	IBA	21873635

MIM	HGNC	e!Ensembl
604390	4403	ENSG00000127920

Protein

UniProt ID

P61952

Protein name

Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11

Protein function

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G prote

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00631	G-gamma	9 → 73	GGL domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in all tissues tested except for brain.

Sequence

MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPED
KNPFKEKGSCVIS

Sequence length

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Chemokine signaling pathway Hormone signaling PI3K-Akt signaling pathway Apelin signaling pathway Circadian entrainment Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Relaxin signaling pathway Morphine addiction Alcoholism Human cytomegalovirus infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection Pathways in cancer		Activation of G protein gated Potassium channels Glucagon signaling in metabolic regulation G-protein activation Glucagon-like Peptide-1 (GLP1) regulates insulin secretion ADP signalling through P2Y purinoceptor 12 G beta:gamma signalling through PI3Kgamma Prostacyclin signalling through prostacyclin receptor Adrenaline,noradrenaline inhibits insulin secretion Ca2+ pathway G alpha (q) signalling events G alpha (12/13) signalling events G beta:gamma signalling through PLC beta G alpha (s) signalling events ADP signalling through P2Y purinoceptor 1 G alpha (i) signalling events G alpha (z) signalling events Glucagon-type ligand receptors Thromboxane signalling through TP receptor Vasopressin regulates renal water homeostasis via Aquaporins Thrombin signalling through proteinase activated receptors (PARs) Presynaptic function of Kainate receptors Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding G beta:gamma signalling through BTK G beta:gamma signalling through CDC42 Extra-nuclear estrogen signaling ADORA2B mediated anti-inflammatory cytokines production Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits

Show/Hide Causal Diseases (2)

Disease term	Disease name	dbSNP ID	References
Causal
Arthritis	Juvenile arthritis	rs1594890601, rs1594882933, rs184370809, rs776489319, rs1594883470	19565504
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)	24366584

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Glioblastoma	Glioblastoma	CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587		GWAS, CBGDA

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma	Associate	33120770
Adenocarcinoma of Lung	Associate	33120770
Blood Coagulation Disorders	Associate	21829388
Carcinoma Non Small Cell Lung	Associate	33669233
Diabetes Gestational	Associate	35370940
Endometrial Neoplasms	Associate	22706224
Glomerulonephritis IGA	Associate	34861820
Leukemia	Associate	20670477
Leukemia Myeloid Acute	Associate	20670477
Lymphoma B Cell Marginal Zone	Associate	15914563
Neoplasms	Associate	37489460
Ovarian Neoplasms	Associate	35120576
Parkinson Disease	Associate	35342758
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	20670477

GNG11 (G protein subunit gamma 11)