Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	2769
Gene name Gene Name - the full gene name approved by the HGNC.	G protein subunit alpha 15
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	GNA15
Synonyms (NCBI Gene) Gene synonyms aliases	GNA16, HG1L
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.3

Show/Hide all(21)

miRTarBase ID	miRNA	Experiments
MIRT1023153	hsa-miR-1184	CLIP-seq
MIRT1023154	hsa-miR-3117-5p	CLIP-seq
MIRT1023155	hsa-miR-4691-3p	CLIP-seq
MIRT1023156	hsa-miR-4704-5p	CLIP-seq
MIRT1023157	hsa-miR-615-5p	CLIP-seq
MIRT2003432	hsa-miR-3173-3p	CLIP-seq
MIRT2003433	hsa-miR-4265	CLIP-seq
MIRT2003434	hsa-miR-4296	CLIP-seq
MIRT2003435	hsa-miR-4322	CLIP-seq
MIRT2003436	hsa-miR-4417	CLIP-seq
MIRT2003437	hsa-miR-4645-3p	CLIP-seq
MIRT2003438	hsa-miR-4738-3p	CLIP-seq
MIRT2003439	hsa-miR-4779	CLIP-seq
MIRT2003440	hsa-miR-542-3p	CLIP-seq
MIRT2236283	hsa-miR-1197	CLIP-seq
MIRT2236284	hsa-miR-1286	CLIP-seq
MIRT2236285	hsa-miR-3180-5p	CLIP-seq
MIRT2236286	hsa-miR-4436a	CLIP-seq
MIRT2003437	hsa-miR-4645-3p	CLIP-seq
MIRT2236287	hsa-miR-4738-5p	CLIP-seq
MIRT2003440	hsa-miR-542-3p	CLIP-seq

Show/Hide all(19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001664	Function	G protein-coupled receptor binding	IDA	10571060
GO:0001664	Function	G protein-coupled receptor binding	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	7797501
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS
GO:0005834	Component	Heterotrimeric G-protein complex	NAS	10571060
GO:0005886	Component	Plasma membrane	TAS	7797501, 8415674
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:0007207	Process	Phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway	TAS	7797501
GO:0019001	Function	Guanyl nucleotide binding	IEA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0019722	Process	Calcium-mediated signaling	IPI	10571060
GO:0031683	Function	G-protein beta/gamma-subunit complex binding	IEA
GO:0045202	Component	Synapse	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
139314	4383	ENSG00000060558

Protein

UniProt ID

P30679

Protein name

Guanine nucleotide-binding protein subunit alpha-15 (G alpha-15) (G-protein subunit alpha-15) (Epididymis tissue protein Li 17E) (Guanine nucleotide-binding protein subunit alpha-16) (G alpha-16) (G-protein subunit alpha-16)

Protein function

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00503	G-alpha	22 → 363	G-protein alpha subunit	Domain

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in hematopoietic cells. Expressed in epididymis (at protein level). {ECO:0000269|PubMed:20736409}.

Sequence

MARSLTWRCCPWCLTEDEKAAARVDQEINRILLEQKKQDRGELKLLLLGPGESGKSTFIK
QMRIIHGAGYSEEERKGFRPLVYQNIFVSMRAMIEAMERLQIPFSRPESKHHASLVMSQD
PYKVTTFEKRYAAAMQWLWRDAGIRAYYERRREFHLLDSAVYYLSHLERITEEGYVPTAQ
DVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQ
CLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQG
PKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVR
DSVLARYLDEINLL

Sequence length

374

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Hormone signaling Relaxin signaling pathway Chagas disease Amoebiasis		Acetylcholine regulates insulin secretion G alpha (q) signalling events ADP signalling through P2Y purinoceptor 1 Thromboxane signalling through TP receptor Fatty Acids bound to GPR40 (FFAR1) regulate insulin secretion Thrombin signalling through proteinase activated receptors (PARs)

Show/Hide Unknown Diseases (2)

Disease merge term	Disease name	Evidence	References	Source
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Asthma	Atopic asthma, Asthma	N/A	N/A	GWAS
Heart Failure	Heart failure	N/A	N/A	GWAS

Show/Hide Text Mining Associations (14)

Disease Name	Relationship Type	References
Associations from Text Mining Disease associations identified through Pubtator
Anophthalmia with pulmonary hypoplasia	Associate	34290274
Carcinogenesis	Associate	34290274
Carcinoma Non Small Cell Lung	Inhibit	24204697
Carcinoma Pancreatic Ductal	Associate	34290274
Carcinoma Squamous Cell	Associate	33960436
Heart Failure	Associate	32066683
Leukemia Biphenotypic Acute	Associate	7703490
Lymphoma	Associate	10861809
Myocarditis	Associate	32066683
Neoplasms	Associate	29307797, 33960436
Ovarian Neoplasms	Associate	29170526, 39991148
Pancreatic Neoplasms	Associate	34290274
Precursor B Cell Lymphoblastic Leukemia Lymphoma	Associate	7703490
Pulmonary Embolism	Associate	24337368

GNA15 (G protein subunit alpha 15)