Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27329
Gene name Gene Name - the full gene name approved by the HGNC.
Angiopoietin like 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
ANGPTL3
Synonyms (NCBI Gene) Gene synonyms aliases
ANG-5, ANGPT5, ANL3, FHBL2
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p31.3
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of a family of secreted proteins that function in angiogenesis. The encoded protein, which is expressed predominantly in the liver, is further processed into an N-terminal coiled-coil domain-containing chain and a C-terminal fib
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT689043 hsa-miR-6890-3p HITS-CLIP 23313552
MIRT689042 hsa-miR-6736-3p HITS-CLIP 23313552
MIRT689041 hsa-miR-4485-5p HITS-CLIP 23313552
MIRT689040 hsa-miR-660-3p HITS-CLIP 23313552
MIRT689039 hsa-miR-939-3p HITS-CLIP 23313552
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0001525 Process Angiogenesis IEA
GO:0004857 Function Enzyme inhibitor activity IEA
GO:0004857 Function Enzyme inhibitor activity ISS
GO:0004859 Function Phospholipase inhibitor activity IBA
GO:0004859 Function Phospholipase inhibitor activity IDA 17110602
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604774 491 ENSG00000132855
Protein
UniProt ID Q9Y5C1
Protein name Angiopoietin-related protein 3 (Angiopoietin-5) (ANG-5) (Angiopoietin-like protein 3) [Cleaved into: ANGPTL3(17-221); ANGPTL3(17-224)]
Protein function Acts in part as a hepatokine that is involved in regulation of lipid and glucose metabolism (PubMed:11788823, PubMed:12909640, PubMed:23661675, PubMed:25495645). Proposed to play a role in the trafficking of energy substrates to either storage o
PDB 6EUA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00147 Fibrinogen_C 242 454 Fibrinogen beta and gamma chains, C-terminal globular domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed principally in liver. Weakly expressed in kidney. Binds to adipocytes. Increased expression and colocalization with activated ITGB3 in glomeruli of patients with nephrotic syndrome showing effaced podocyte foot processes (at
Sequence
MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDF
VHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
NSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQ
TVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHD
GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWE
NYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTL
HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP
RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPT
DSESFE
Sequence length 460
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cholesterol metabolism   Assembly of active LPL and LIPC lipase complexes
NR1H2 & NR1H3 regulate gene expression linked to lipogenesis
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Hypobetalipoproteinemia familial hypobetalipoproteinemia 2 N/A N/A GenCC
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Abetalipoproteinemia Associate 27179706
Adenocarcinoma of Lung Inhibit 22048948
Anorexia Nervosa Associate 29695708
Atherosclerosis Associate 29618844, 33580780, 33887960, 37626170
Atherosclerosis Inhibit 34865644, 38243829
Atrophy Associate 35755170
Breast Neoplasms Associate 31642813
Bronchopulmonary Dysplasia Associate 35595912
Carcinoma Hepatocellular Associate 32443377
Carcinoma Renal Cell Associate 34484467, 37919459