Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27324
Gene name Gene Name - the full gene name approved by the HGNC.	TOX high mobility group box family member 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	TOX3
Synonyms (NCBI Gene) Gene synonyms aliases	CAGF9, TNRC9
Chromosome Chromosome number	16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	16q12.1
Summary Summary of gene provided in NCBI Entrez Gene.	The protein encoded by this gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequen

Show/Hide all(43)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052048	hsa-let-7b-5p	CLASH	23622248
MIRT045405	hsa-miR-149-5p	CLASH	23622248
MIRT1447910	hsa-miR-4684-3p	CLIP-seq
MIRT1447911	hsa-miR-4711-5p	CLIP-seq
MIRT2355006	hsa-miR-1279	CLIP-seq
MIRT2355007	hsa-miR-1296	CLIP-seq
MIRT2355008	hsa-miR-1323	CLIP-seq
MIRT2355009	hsa-miR-1915	CLIP-seq
MIRT2355010	hsa-miR-23a	CLIP-seq
MIRT2355011	hsa-miR-23b	CLIP-seq
MIRT2355012	hsa-miR-23c	CLIP-seq
MIRT2355013	hsa-miR-2909	CLIP-seq
MIRT2355014	hsa-miR-299-5p	CLIP-seq
MIRT2355015	hsa-miR-3158-3p	CLIP-seq
MIRT2355016	hsa-miR-331-5p	CLIP-seq
MIRT2355017	hsa-miR-3651	CLIP-seq
MIRT2355018	hsa-miR-3669	CLIP-seq
MIRT2355019	hsa-miR-371b-5p	CLIP-seq
MIRT2355020	hsa-miR-4293	CLIP-seq
MIRT2355021	hsa-miR-4433	CLIP-seq
MIRT2355022	hsa-miR-4446-3p	CLIP-seq
MIRT2355023	hsa-miR-4459	CLIP-seq
MIRT2355024	hsa-miR-4678	CLIP-seq
MIRT2355025	hsa-miR-4726-3p	CLIP-seq
MIRT2355026	hsa-miR-4768-3p	CLIP-seq
MIRT2355027	hsa-miR-548o	CLIP-seq
MIRT2355028	hsa-miR-596	CLIP-seq
MIRT2355029	hsa-miR-664	CLIP-seq
MIRT2355030	hsa-miR-668	CLIP-seq
MIRT2355031	hsa-miR-888	CLIP-seq
MIRT2355006	hsa-miR-1279	CLIP-seq
MIRT2355032	hsa-miR-4729	CLIP-seq
MIRT2462158	hsa-miR-3609	CLIP-seq
MIRT2462159	hsa-miR-520g	CLIP-seq
MIRT2462160	hsa-miR-520h	CLIP-seq
MIRT2462161	hsa-miR-548ac	CLIP-seq
MIRT2462162	hsa-miR-548ae	CLIP-seq
MIRT2462163	hsa-miR-548ah	CLIP-seq
MIRT2462164	hsa-miR-548aj	CLIP-seq
MIRT2462165	hsa-miR-548am	CLIP-seq
MIRT2462166	hsa-miR-548d-3p	CLIP-seq
MIRT2462167	hsa-miR-548x	CLIP-seq
MIRT2462168	hsa-miR-548z	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003682	Function	Chromatin binding	IDA	21172805
GO:0003713	Function	Transcription coactivator activity	IDA	21172805
GO:0005515	Function	Protein binding	IPI	21172805
GO:0005634	Component	Nucleus	IBA	21873635
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA	21873635
GO:0006915	Process	Apoptotic process	IEA
GO:0031490	Function	Chromatin DNA binding	IBA	21873635
GO:0042803	Function	Protein homodimerization activity	IDA	21172805
GO:0042981	Process	Regulation of apoptotic process	IDA	21172805
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	21172805
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21172805
GO:0051219	Function	Phosphoprotein binding	IPI	21172805

MIM	HGNC	e!Ensembl
611416	11972	ENSG00000103460

Protein

UniProt ID

O15405

Protein name

TOX high mobility group box family member 3 (CAG trinucleotide repeat-containing gene F9 protein) (Trinucleotide repeat-containing gene 9 protein)

Protein function

Transcriptional coactivator of the p300/CBP-mediated transcription complex. Activates transactivation through cAMP response element (CRE) sites. Protects against cell death by inducing antiapoptotic and repressing pro-apoptotic transcripts. Stim

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00505	HMG_box	255 → 323	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly in epithelial cells. Expressed in the central nervous system (CNS), in the ileum and within the brain in the frontal and occipital lobe. {ECO:0000269|PubMed:21172805}.

Sequence

MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLG
DEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISR
NLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQS
QLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKK
PKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ
KQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNT
PLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG
TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQ
HFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQI
TSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF

Sequence length

576

Interactions

View interactions

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Breast cancer	Malignant neoplasm of breast	rs587776547, rs1137887, rs137853007, rs587776650, rs80359351, rs80359714, rs121917783, rs104886456, rs121964878, rs80359874, rs80357868, rs80357508, rs387906843, rs80357569, rs80358158 View all (309 more)	17529967
Breast carcinoma	Breast Carcinoma	rs80359671, rs11540652, rs28934575, rs28897672, rs137886232, rs193922376, rs80357783, rs80359306, rs80359405, rs80359507, rs80359598, rs80358429, rs397507683, rs397515636, rs80359451 View all (71 more)	25956309, 24493630, 17529967
Marfan syndrome	Mammary Carcinoma, Human	rs137854456, rs137854457, rs267606796, rs137854458, rs137854459, rs137854460, rs137854470, rs137854471, rs267606797, rs137854461, rs137854462, rs137854463, rs869025419, rs137854464, rs137854465 View all (942 more)	17529967

Show/Hide Unknown Diseases (5)

Disease term	Disease name	Source
Unknown
Neuroticism	Neuroticism	GWAS
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWAS
Metabolic Syndrome	Metabolic Syndrome	GWAS
Insomnia	Insomnia	GWAS
Restless Legs Syndrome	Restless Legs Syndrome	GWAS

Show/Hide Text Mining Associations (28)

Disease Name	Relationship Type	References
Associations from Text Mining
Breast Neoplasms	Associate	17529967, 18355772, 18437204, 18612136, 18681954, 19232126, 19304784, 19656774, 20332101, 20406955, 20484103, 20699374, 21118973, 21475998, 21795501 View all (37 more)
Breast Neoplasms	Stimulate	19094228
Breast Neoplasms Male	Associate	21949660, 23001122
Carcinogenesis	Associate	22496870
Carcinoma Lobular	Associate	23270421
Carcinoma Renal Cell	Associate	32789468
Colorectal Neoplasms	Stimulate	32393998
Death	Associate	23635555, 24069142
Feeding and Eating Disorders	Associate	37752455
Hereditary Breast and Ovarian Cancer Syndrome	Associate	22496870
Inflammation	Associate	28068351
Insulin Resistance	Associate	32425888
Leukemia Myelogenous Chronic BCR ABL Positive	Associate	26822197
Lung Diseases	Associate	22496870
Lung Neoplasms	Associate	27486757
Metabolic Syndrome	Associate	32425888
Multiple Sclerosis	Associate	36232761
Neoplasms	Associate	22496870, 23577780, 24069272, 25139936, 26822197, 31317673
Neoplasms	Stimulate	27806084
Nocturnal Myoclonus Syndrome	Associate	25142570, 26703954
Obesity	Associate	27241640
Orofacial Cleft 1	Associate	26868259, 30924295
Ovarian Neoplasms	Associate	19304784
Polycystic Ovary Syndrome	Associate	28068351, 28537684, 32425888, 37223019, 39273163
Restless Legs Syndrome	Associate	21779176, 25142570
Signs and Symptoms Respiratory	Associate	30449631
Stomach Neoplasms	Associate	24069142
Triple Negative Breast Neoplasms	Associate	21844186, 24325915, 35200585, 36157217

TOX3 (TOX high mobility group box family member 3)