TOX3 (TOX high mobility group box family member 3)

Gene

• Entrez ID: 27324
• Gene name: TOX high mobility group box family member 3
• Gene symbol: TOX3
• Synonyms (NCBI Gene): CAGF9, TNRC9
• Chromosome: 16
• Chromosome location: 16q12.1
• Summary: The protein encoded by this gene contains an HMG-box, indicating that it may be involved in bending and unwinding of DNA and alteration of chromatin structure. The C-terminus of the encoded protein is glutamine-rich due to CAG repeats in the coding sequen

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT052048	hsa-let-7b-5p	CLASH	23622248
MIRT045405	hsa-miR-149-5p	CLASH	23622248
MIRT1447910	hsa-miR-4684-3p	CLIP-seq
MIRT1447911	hsa-miR-4711-5p	CLIP-seq
MIRT2355006	hsa-miR-1279	CLIP-seq
MIRT2355007	hsa-miR-1296	CLIP-seq
MIRT2355008	hsa-miR-1323	CLIP-seq
MIRT2355009	hsa-miR-1915	CLIP-seq
MIRT2355010	hsa-miR-23a	CLIP-seq
MIRT2355011	hsa-miR-23b	CLIP-seq
MIRT2355012	hsa-miR-23c	CLIP-seq
MIRT2355013	hsa-miR-2909	CLIP-seq
MIRT2355014	hsa-miR-299-5p	CLIP-seq
MIRT2355015	hsa-miR-3158-3p	CLIP-seq
MIRT2355016	hsa-miR-331-5p	CLIP-seq
MIRT2355017	hsa-miR-3651	CLIP-seq
MIRT2355018	hsa-miR-3669	CLIP-seq
MIRT2355019	hsa-miR-371b-5p	CLIP-seq
MIRT2355020	hsa-miR-4293	CLIP-seq
MIRT2355021	hsa-miR-4433	CLIP-seq
MIRT2355022	hsa-miR-4446-3p	CLIP-seq
MIRT2355023	hsa-miR-4459	CLIP-seq
MIRT2355024	hsa-miR-4678	CLIP-seq
MIRT2355025	hsa-miR-4726-3p	CLIP-seq
MIRT2355026	hsa-miR-4768-3p	CLIP-seq
MIRT2355027	hsa-miR-548o	CLIP-seq
MIRT2355028	hsa-miR-596	CLIP-seq
MIRT2355029	hsa-miR-664	CLIP-seq
MIRT2355030	hsa-miR-668	CLIP-seq
MIRT2355031	hsa-miR-888	CLIP-seq
MIRT2355006	hsa-miR-1279	CLIP-seq
MIRT2355032	hsa-miR-4729	CLIP-seq
MIRT2462158	hsa-miR-3609	CLIP-seq
MIRT2462159	hsa-miR-520g	CLIP-seq
MIRT2462160	hsa-miR-520h	CLIP-seq
MIRT2462161	hsa-miR-548ac	CLIP-seq
MIRT2462162	hsa-miR-548ae	CLIP-seq
MIRT2462163	hsa-miR-548ah	CLIP-seq
MIRT2462164	hsa-miR-548aj	CLIP-seq
MIRT2462165	hsa-miR-548am	CLIP-seq
MIRT2462166	hsa-miR-548d-3p	CLIP-seq
MIRT2462167	hsa-miR-548x	CLIP-seq
MIRT2462168	hsa-miR-548z	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	21172805
GO:0003713	Function	Transcription coactivator activity	IDA	21172805
GO:0005515	Function	Protein binding	IPI	21172805
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0042803	Function	Protein homodimerization activity	IDA	21172805
GO:0042981	Process	Regulation of apoptotic process	IDA	21172805
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	21172805
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	21172805
GO:0051219	Function	Phosphoprotein binding	IPI	21172805

Other IDs

• MIM: 611416
• HGNC: 11972
• e!Ensembl: ENSG00000103460

Protein

• UniProt ID: O15405
• Protein name: TOX high mobility group box family member 3 (CAG trinucleotide repeat-containing gene F9 protein) (Trinucleotide repeat-containing gene 9 protein)
• Protein function: Transcriptional coactivator of the p300/CBP-mediated transcription complex. Activates transactivation through cAMP response element (CRE) sites. Protects against cell death by inducing antiapoptotic and repressing pro-apoptotic transcripts. Stim
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00505	HMG_box	255 → 323	HMG (high mobility group) box	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed mainly in epithelial cells. Expressed in the central nervous system (CNS), in the ileum and within the brain in the frontal and occipital lobe. {ECO:0000269|PubMed:21172805}.
• Sequence:

  MDVRFYPAAAGDPASLDFAQCLGYYGYSKFGNNNNYMNMAEANNAFFAASEQTFHTPSLG
  DEEFEIPPITPPPESDPALGMPDVLLPFQALSDPLPSQGSEFTPQFPPQSLDLPSITISR
  NLVEQDGVLHSSGLHMDQSHTQVSQYRQDPSLIMRSIVHMTDAARSGVMPPAQLTTINQS
  QLSAQLGLNLGGASMPHTSPSPPASKSATPSPSSSINEEDADEANRAIGEKRAAPDSGKK
  PKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWDSLGEEQ
  KQVYKRKTEAAKKEYLKALAAYRASLVSKAAAESAEAQTIRSVQQTLASTNLTSSLLLNT
  PLSQHGTVSASPQTLQQSLPRSIAPKPLTMRLPMNQIVTSVTIAANMPSNIGAPLISSMG
  TTMVGSAPSTQVSPSVQTQQHQMQLQQQQQQQQQQMQQMQQQQLQQHQMHQQIQQQMQQQ
  HFQHHMQQHLQQQQQHLQQQINQQQLQQQLQQRLQLQQLQHMQHQSQPSPRQHSPVASQI
  TSPIPAIGSPQPASQQHQSQIQSQTQTQVLSQVSIF

• Sequence length: 576