Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27129
Gene name Gene Name - the full gene name approved by the HGNC.
Heat shock protein family B (small) member 7
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
HSPB7
Synonyms (NCBI Gene) Gene synonyms aliases
cvHSP
Chromosome Chromosome number
1
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
1p36.13
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway,
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT022635 hsa-miR-124-3p Microarray 18668037
MIRT027658 hsa-miR-98-5p Microarray 19088304
MIRT029397 hsa-miR-26b-5p Microarray 19088304
MIRT1056430 hsa-miR-1193 CLIP-seq
MIRT1056431 hsa-miR-1254 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 14594798, 16189514, 25416956, 28514442, 32296183
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 19464326
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
610692 5249 ENSG00000173641
Protein
UniProt ID Q9UBY9
Protein name Heat shock protein beta-7 (HspB7) (Cardiovascular heat shock protein) (cvHsp)
PDB 8PA0 , 8RHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00011 HSP20 74 170 Hsp20/alpha crystallin family Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
Sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS
EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMN
TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
Sequence length 170
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Cardiomyopathy Cardiomyopathy, Dilated rs267607003, rs267607002, rs267607004, rs63750743, rs121908333, rs121908334, rs104894655, rs121434420, rs121434421, rs193922674, rs111517471, rs121908987, rs193922384, rs121909374, rs121909377
View all (900 more)
20975947
Unknown
Disease term Disease name Evidence References Source
Hypertrophic cardiomyopathy Hypertrophic cardiomyopathy GWAS
Associations from Text Mining
Disease Name Relationship Type References
Bone Diseases Metabolic Associate 37170285
Brain Ischemia Associate 20124441
Carcinoma Renal Cell Inhibit 24585183
Carcinoma Squamous Cell Associate 38084139
Cardiomyopathies Associate 20038796
Cardiomyopathy Dilated Associate 20975947, 21459883, 23570452, 28296976, 32916098
familial dilated cardiomyopathy Associate 21459883
Heart Failure Associate 20038796, 20124441, 21248228, 22499703, 31554410
Heart Failure Systolic Associate 20038796
Neoplasms Inhibit 24585183, 29577611