Gene Gene information from NCBI Gene database.
Entrez ID 27129
Gene name Heat shock protein family B (small) member 7
Gene symbol HSPB7
Synonyms (NCBI Gene)
cvHSP
Chromosome 1
Chromosome location 1p36.13
Summary This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway,
miRNA miRNA information provided by mirtarbase database.
105
miRTarBase ID miRNA Experiments Reference
MIRT022635 hsa-miR-124-3p Microarray 18668037
MIRT027658 hsa-miR-98-5p Microarray 19088304
MIRT029397 hsa-miR-26b-5p Microarray 19088304
MIRT1056430 hsa-miR-1193 CLIP-seq
MIRT1056431 hsa-miR-1254 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 14594798, 16189514, 25416956, 28514442, 32296183
GO:0005515 Function Protein binding TAS 10593960
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 19464326
GO:0005634 Component Nucleus IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610692 5249 ENSG00000173641
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBY9
Protein name Heat shock protein beta-7 (HspB7) (Cardiovascular heat shock protein) (cvHsp)
PDB 8PA0 , 8RHA
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00011 HSP20 74 170 Hsp20/alpha crystallin family Family
Tissue specificity TISSUE SPECIFICITY: Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.
Sequence
MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS
EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMN
TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI
Sequence length 170
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
1
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Oromandibular-limb hypogenesis spectrum Likely benign rs530970423 RCV000239981
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Bone Diseases Metabolic Associate 37170285
Brain Ischemia Associate 20124441
Carcinoma Renal Cell Inhibit 24585183
Carcinoma Squamous Cell Associate 38084139
Cardiomyopathies Associate 20038796
Cardiomyopathy Dilated Associate 20975947, 21459883, 23570452, 28296976, 32916098
familial dilated cardiomyopathy Associate 21459883
Heart Failure Associate 20038796, 20124441, 21248228, 22499703, 31554410
Heart Failure Systolic Associate 20038796
Neoplasms Inhibit 24585183, 29577611