Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	27123
Gene name Gene Name - the full gene name approved by the HGNC.	Dickkopf Wnt signaling pathway inhibitor 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	DKK2
Synonyms (NCBI Gene) Gene synonyms aliases	DKK-2
Chromosome Chromosome number	4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	4q25
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist

Show/Hide all(75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007048	hsa-miR-218-5p	Luciferase reporter assay	23060446
MIRT018639	hsa-miR-335-5p	Microarray	18185580
MIRT003362	hsa-miR-221-3p	Reporter assay;Microarray	20018759
MIRT053325	hsa-miR-222-3p	Luciferase reporter assay, qRT-PCR, Western blot	23587485
MIRT053327	hsa-miR-1260b	Luciferase reporter assay, qRT-PCR, Western blot	23591200
MIRT007048	hsa-miR-218-5p	Luciferase reporter assay, qRT-PCR, Western blot	24091133
MIRT731607	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26656471
MIRT731607	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	26656471
MIRT003362	hsa-miR-221-3p	Luciferase reporter assay, qRT-PCR, Western blot	27501171
MIRT736035	hsa-miR-203a-3p	Luciferase reporter assay, Western blotting	31489578
MIRT937664	hsa-miR-141	CLIP-seq
MIRT937665	hsa-miR-200a	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT937668	hsa-miR-2113	CLIP-seq
MIRT937669	hsa-miR-217	CLIP-seq
MIRT937670	hsa-miR-298	CLIP-seq
MIRT937671	hsa-miR-3064-5p	CLIP-seq
MIRT937672	hsa-miR-3187-3p	CLIP-seq
MIRT937673	hsa-miR-3678-3p	CLIP-seq
MIRT937674	hsa-miR-3688-3p	CLIP-seq
MIRT937675	hsa-miR-369-3p	CLIP-seq
MIRT937676	hsa-miR-374a	CLIP-seq
MIRT937677	hsa-miR-374b	CLIP-seq
MIRT937678	hsa-miR-4261	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT937681	hsa-miR-450b-5p	CLIP-seq
MIRT937682	hsa-miR-4529-5p	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT937684	hsa-miR-4793-3p	CLIP-seq
MIRT937685	hsa-miR-507	CLIP-seq
MIRT937686	hsa-miR-557	CLIP-seq
MIRT937687	hsa-miR-604	CLIP-seq
MIRT937688	hsa-miR-647	CLIP-seq
MIRT937689	hsa-miR-758	CLIP-seq
MIRT937690	hsa-miR-892b	CLIP-seq
MIRT937691	hsa-miR-944	CLIP-seq
MIRT1977560	hsa-miR-1252	CLIP-seq
MIRT1977561	hsa-miR-4496	CLIP-seq
MIRT1977562	hsa-miR-4652-3p	CLIP-seq
MIRT1977563	hsa-miR-545	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT937668	hsa-miR-2113	CLIP-seq
MIRT2212831	hsa-miR-3194-3p	CLIP-seq
MIRT2212832	hsa-miR-3647-3p	CLIP-seq
MIRT937674	hsa-miR-3688-3p	CLIP-seq
MIRT937678	hsa-miR-4261	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT2212833	hsa-miR-4713-5p	CLIP-seq
MIRT937689	hsa-miR-758	CLIP-seq
MIRT2212834	hsa-miR-767-3p	CLIP-seq
MIRT2516665	hsa-miR-1206	CLIP-seq
MIRT2516666	hsa-miR-153	CLIP-seq
MIRT937666	hsa-miR-204	CLIP-seq
MIRT937667	hsa-miR-211	CLIP-seq
MIRT2516667	hsa-miR-342-3p	CLIP-seq
MIRT2516668	hsa-miR-3618	CLIP-seq
MIRT2516669	hsa-miR-4277	CLIP-seq
MIRT937679	hsa-miR-4287	CLIP-seq
MIRT2516670	hsa-miR-4307	CLIP-seq
MIRT2516671	hsa-miR-4452	CLIP-seq
MIRT937680	hsa-miR-4469	CLIP-seq
MIRT2516672	hsa-miR-4680-3p	CLIP-seq
MIRT937683	hsa-miR-4685-3p	CLIP-seq
MIRT2516673	hsa-miR-4700-3p	CLIP-seq
MIRT2212833	hsa-miR-4713-5p	CLIP-seq
MIRT2516674	hsa-miR-4760-3p	CLIP-seq
MIRT2516675	hsa-miR-548p	CLIP-seq
MIRT2516676	hsa-miR-576-5p	CLIP-seq
MIRT2516677	hsa-miR-656	CLIP-seq
MIRT2516678	hsa-miR-660	CLIP-seq

Show/Hide all(14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005615	Component	Extracellular space	IBA	21873635
GO:0005615	Component	Extracellular space	IDA	11742004
GO:0007275	Process	Multicellular organism development	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0039706	Function	Co-receptor binding	IBA	21873635
GO:0048019	Function	Receptor antagonist activity	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA	21873635
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	11742004
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	23587485
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	NAS	24431302
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	12857724
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	NAS	24431302
GO:2000272	Process	Negative regulation of signaling receptor activity	IEA

MIM	HGNC	e!Ensembl
605415	2892	ENSG00000155011

Protein

UniProt ID

Q9UBU2

Protein name

Dickkopf-related protein 2 (Dickkopf-2) (Dkk-2) (hDkk-2)

Protein function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04706	Dickkopf_N	77 → 128	Dickkopf N-terminal cysteine-rich region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, skeletal muscle and lung.

Sequence

MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG
DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI

Sequence length

259

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway Alzheimer disease Pathways of neurodegeneration - multiple diseases		Negative regulation of TCF-dependent signaling by WNT ligand antagonists Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

Show/Hide Unknown Diseases (1)

Disease term	Disease name	Evidence	References	Source
Unknown
Oligodendroglioma	Oligodendroglioma			GWAS

Show/Hide Text Mining Associations (44)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenoma	Associate	25432628, 27896617
Adenomatous Polyposis Coli	Inhibit	29431745
Anxiety	Associate	37029353
Aortic Dissection	Associate	36959563
Beta ketothiolase deficiency	Associate	33909798
Bone Diseases Metabolic	Associate	24584697
Breast Neoplasms	Associate	30320375
Carcinogenesis	Associate	27203079
Carcinoma Hepatocellular	Associate	27203079
Carcinoma Ovarian Epithelial	Associate	33679613
Carcinoma Pancreatic Ductal	Associate	31583260
Carcinoma Renal Cell	Stimulate	33679613
Colonic Diseases	Associate	15858124
Colorectal Neoplasms	Associate	19659606, 29945573, 30867812, 33909798
Diabetes Gestational	Associate	35721735
Esophageal Neoplasms	Associate	30990378
Esophageal Squamous Cell Carcinoma	Associate	30990378
Gallbladder Neoplasms	Associate	26715268
Hypoxia	Stimulate	25312721
Intestinal Neoplasms	Associate	29431745
Kidney Neoplasms	Associate	23591200
Lung Diseases Interstitial	Associate	37587067
Medulloblastoma	Associate	23567267
Melanoma	Associate	29431745
Meningomyelocele	Associate	39774454
Mouth Neoplasms	Associate	23999978
Muscular Dystrophy Duchenne	Associate	18021006
Neoplasms	Associate	23999978, 27203079, 28152305, 29431745, 30867812, 31583260, 33909798
Neoplasms	Stimulate	25432628
Neoplasms	Inhibit	27203079
Neuroblastoma	Associate	21909813
Osteoarthritis	Stimulate	25312721, 29257293
Osteoarthritis	Associate	29806631
Ovarian Neoplasms	Associate	33679613
Ovarian Neoplasms	Stimulate	39972314
Polycystic Ovary Syndrome	Associate	22344199
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	27296949
Prostatic Neoplasms	Associate	33488078
Sarcoma Ewing	Associate	19247449
Scleroderma Diffuse	Inhibit	22328118
Scleroderma Systemic	Associate	37587067
Self Mutilation	Associate	37029353
Squamous Cell Carcinoma of Head and Neck	Associate	23999978
Stomach Neoplasms	Associate	23942619, 28152305

DKK2 (dickkopf Wnt signaling pathway inhibitor 2)