DKK4 (dickkopf Wnt signaling pathway inhibitor 4)

Gene
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27121
Gene name Gene Name - the full gene name approved by the HGNC.
Dickkopf Wnt signaling pathway inhibitor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DKK4
Synonyms (NCBI Gene) Gene synonyms aliases
DKK-4
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modu
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(2)
miRTarBase ID miRNA Experiments Reference
MIRT017610 hsa-miR-335-5p Microarray 18185580
MIRT050225 hsa-miR-25-3p CLASH 23622248
Transcription factors
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(1)
Transcription factor Regulation Reference
VDR Repression 18408752
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(13)
GO ID Ontology Definition Evidence Reference
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005575 Component Cellular_component ND
GO:0005615 Component Extracellular space IBA 21873635
GO:0007275 Process Multicellular organism development IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
605417 2894 ENSG00000104371
Protein
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Q9UBT3
Protein name Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into: Dickkopf-related protein 4 short form]
Protein function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
PDB 5O57
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04706 Dickkopf_N 40 → 91 Dickkopf N-terminal cysteine-rich region Family
PF06607 Prokineticin 135 → 213 Prokineticin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in cerebellum, T-cells, esophagus and lung.
Sequence 
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Sequence length 224
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Wnt signaling pathway
Alzheimer disease
Pathways of neurodegeneration - multiple diseases 		  Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 17553464
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Mental depression Mental Depression, Depressive disorder 19204725 ClinVar
Show/Hide Text Mining Associations (24)
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 23516639
Calculi Associate 39943638
Carcinogenesis Associate 28666421
Carcinoma Non Small Cell Lung Associate 28981599
Carcinoma Ovarian Epithelial Stimulate 28666421
Carcinoma Renal Cell Associate 21472712
Cardiomyopathies Associate 27444932
Charcot Marie Tooth disease Type 1C Associate 19309775
Colorectal Neoplasms Stimulate 19659606
Colorectal Neoplasms Associate 22216841, 29467240, 37096225