DKK4 (dickkopf Wnt signaling pathway inhibitor 4)

Gene Gene information from NCBI Gene database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Entrez ID 27121
Gene name Dickkopf Wnt signaling pathway inhibitor 4
Gene symbol DKK4
Synonyms (NCBI Gene)
DKK-4
Chromosome 8
Chromosome location 8p11.21
Summary This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modu
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT017610 hsa-miR-335-5p Microarray 18185580
MIRT050225 hsa-miR-25-3p CLASH 23622248
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (1)
Transcription factor Regulation Reference
VDR Repression 18408752
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
Show/Hide all (12)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0016055 Process Wnt signaling pathway IEA
GO:0016055 Process Wnt signaling pathway IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
MIM HGNC e!Ensembl
605417 2894 ENSG00000104371
Protein Protein information from UniProt database.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UBT3
Protein name Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into: Dickkopf-related protein 4 short form]
Protein function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
PDB 5O57
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04706 Dickkopf_N 40 → 91 Dickkopf N-terminal cysteine-rich region Family
PF06607 Prokineticin 135 → 213 Prokineticin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in cerebellum, T-cells, esophagus and lung.
Sequence 
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
Sequence length 224
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways
  KEGG  Reactome
  Wnt signaling pathway
Alzheimer disease
Pathways of neurodegeneration - multiple diseases 		  Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling