Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27121
Gene name Gene Name - the full gene name approved by the HGNC.
Dickkopf Wnt signaling pathway inhibitor 4
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
DKK4
Synonyms (NCBI Gene) Gene synonyms aliases
DKK-4
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8p11.21
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. Activity of this protein is modu
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017610 hsa-miR-335-5p Microarray 18185580
MIRT050225 hsa-miR-25-3p CLASH 23622248
Transcription factors
Transcription factor Regulation Reference
VDR Repression 18408752
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183, 32814053
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IBA
GO:0016055 Process Wnt signaling pathway IEA
GO:0016055 Process Wnt signaling pathway IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605417 2894 ENSG00000104371
Protein
UniProt ID Q9UBT3
Protein name Dickkopf-related protein 4 (Dickkopf-4) (Dkk-4) (hDkk-4) [Cleaved into: Dickkopf-related protein 4 short form]
Protein function Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,
PDB 5O57
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04706 Dickkopf_N 40 91 Dickkopf N-terminal cysteine-rich region Family
PF06607 Prokineticin 135 213 Prokineticin Family
Tissue specificity TISSUE SPECIFICITY: Expressed in cerebellum, T-cells, esophagus and lung.
Sequence
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCT
TMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHA
RLRVCQKIEKL
Sequence length 224
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Wnt signaling pathway
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
  Negative regulation of TCF-dependent signaling by WNT ligand antagonists
Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling
<