Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
27115
Gene name Gene Name - the full gene name approved by the HGNC.
Phosphodiesterase 7B
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PDE7B
Synonyms (NCBI Gene) Gene synonyms aliases
bA472E5.1
Chromosome Chromosome number
6
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
6q23.3
Summary Summary of gene provided in NCBI Entrez Gene.
The 3`,5`-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways. 3`,5`-cyclic nucleotide phosphodiesterases (PDEs) catalyze the hydrolysis of cAMP and cGMP to the corresponding 5`-monophosphates a
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT672230 hsa-miR-6715a-3p HITS-CLIP 23824327
MIRT672229 hsa-miR-4717-3p HITS-CLIP 23824327
MIRT672228 hsa-miR-6715b-3p HITS-CLIP 23824327
MIRT672227 hsa-miR-607 HITS-CLIP 23824327
MIRT672226 hsa-miR-1305 HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004114 Function 3',5'-cyclic-nucleotide phosphodiesterase activity IBA 21873635
GO:0004115 Function 3',5'-cyclic-AMP phosphodiesterase activity IBA 21873635
GO:0005829 Component Cytosol TAS
GO:0006198 Process CAMP catabolic process IEA
GO:0007165 Process Signal transduction IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
604645 8792 ENSG00000171408
Protein
UniProt ID Q9NP56
Protein name 3',5'-cyclic-AMP phosphodiesterase 7B (EC 3.1.4.53) (cAMP-specific phosphodiesterase 7B)
Protein function Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes (PubMed:10814504, PubMed:10872825). May be involved in the control of cAMP-mediated neural activity and cAMP metabolism in the brain (PubMed
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00233 PDEase_I 172 406 Domain
Tissue specificity TISSUE SPECIFICITY: Highly expressed in brain (PubMed:10814504). Also expressed in heart, liver, skeletal muscle and pancreas (PubMed:10814504). {ECO:0000269|PubMed:10814504}.
Sequence
MSCLMVERCGEILFENPDQNAKCVCMLGDIRLRGQTGVRAERRGSYPFIDFRLLNSTTYS
GEIGTKKKVKRLLSFQRYFHASRLLRGIIPQAPLHLLDEDYLGQARHMLSKVGMWDFDIF
LFDRLTNGNSLVTLLCHLFNTHGLIHHFKLDMVTLHRFLVMVQEDYHSQNPYHNAVHAAD
VTQAMHCYLKEPKLASFLTPLDIMLGLLAAAAHDVDHPGVNQPFLIKTNHHLANLYQNMS
VLENHHWRSTIGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN
KDLRLEDAQDRHFMLQIALKCADICNPCRIWEMSKQWSERVCEEFYRQGELEQKFELEIS
PLCNQQKDSIPSIQIGFMSYIVEPLFREWAHFTGNSTLSENMLGHL
AHNKAQWKSLLPRQ
HRSRGSSGSGPDHDHAGQGTESEEQEGDSP
Sequence length 450
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Purine metabolism
Metabolic pathways
Morphine addiction
  G alpha (s) signalling events
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Causal
Disease term Disease name dbSNP ID References
Alzheimer disease Alzheimer`s Disease rs63750215, rs28936379, rs63749851, rs63749884, rs28936380, rs63750048, rs63750579, rs63750264, rs63749964, rs63750671, rs281865161, rs63750066, rs63750399, rs63750734, rs63751039
View all (65 more)
23535033
Glaucoma Glaucoma, Glaucoma, Open-Angle rs121918355, rs1566660365, rs1566635134, rs121918356, rs1566634475, rs28936700, rs55771538, rs28936701, rs104893622, rs55989760, rs72549387, rs104893628, rs2125316417, rs104893629, rs74315328
View all (29 more)
30054594, 29891935
Narcolepsy Narcolepsy rs104894574, rs387906655 19629137
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)
20371615, 19850283, 20071346
Unknown
Disease term Disease name Evidence References Source
Asthma Childhood asthma 29551627 ClinVar
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA
Diverticulitis Diverticulitis GWAS
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Associations from Text Mining
Disease Name Relationship Type References
Breast Neoplasms Associate 30209363
Colorectal Neoplasms Associate 37632791
Diabetes Mellitus Type 2 Associate 24603685
Fibrous Dysplasia of Bone Associate 31999703
Leukemia Associate 31740742
Leukemia Lymphocytic Chronic B Cell Associate 19033455, 21796143
Leukemia Myeloid Acute Associate 31740742
Neoplasms Associate 30209363
Prostatic Neoplasms Associate 25979379
Triple Negative Breast Neoplasms Associate 30209363